From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005586000
  • symbol?: lacE
  • description?: PTS system lactose-specific transporter subunit IIBC

      descriptions from strain specific annotations:

    • PTS system lactose-specific transporter subunit IIBC
    • PTS system, lactose-specific IIBC component
    • PTS system, lactose-specific IIB component / PTS system, lactose-specific IIC component
    • PTS system lactose-specific EIICB component
    • PTS system lactose-specific transporter subunit IIC
    • PTS system, lactose-specific IIBC components
    • PTS system lactose-specific IIBC component
    • pts system, lactose-specific transporter subunit IIBC
    • PTS system lactose/cellobiose-specific IIBC component
    • PTS family lactose-N,N-diacetylchitobiose-beta-glucoside (lac) porter component IIBC
    • PTS system lactose transporter subunit IICB
  • strand?: -
  • coordinates?: 5727235..5728944
  • synteny block?: BlockID0043460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2181 (lacE)
    N315:
    SA1992 (lacE)
    NCTC8325:
    Newman:
    NWMN_2094 (lacE)
    USA300_FPR3757:
    04-02981:
    SA2981_2128 (lacE)
    08BA02176:
    C248_2228 (lacE)
    11819-97:
    MS7_2213 (lacE)
    71193:
    ST398NM01_2250
    ECT-R 2:
    ECTR2_2051
    ED133:
    SAOV_2237c
    ED98:
    SAAV_2251 (lacE)
    HO 5096 0412:
    SAEMRSA15_20950 (lacE)
    JH1:
    SaurJH1_2260
    JH9:
    SaurJH9_2221
    JKD6008:
    SAA6008_02231
    JKD6159:
    SAA6159_02101
    LGA251:
    SARLGA251_19850 (lacE)
    M013:
    M013TW_2156
    MRSA252:
    SAR2281 (lacE)
    MSHR1132:
    SAMSHR1132_20220
    MSSA476:
    SAS2091
    Mu3:
    SAHV_2174 (lacE)
    Mu50:
    SAV2190 (lacE)
    MW2:
    MW2116 (lacE)
    RF122:
    SAB2071c (lacE)
    ST398:
    SAPIG2250
    T0131:
    SAT0131_02364
    TCH60:
    HMPREF0772_11001 (lacE)
    TW20:
    SATW20_23280 (lacE)
    USA300_TCH1516:
    USA300HOU_2183 (lacE)
    VC40:
    SAVC_09840 (lacE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTMMQKLIAQIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFGFK
    N315            --MMQKLIAQIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFGFK
    NCTC8325        --MMQKLIAQIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFGFK
    Newman          --MMQKLIAQIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFGFK
    USA300_FPR3757  --MMQKLIAQIEKGKPFFEKLSRNIYLRAIRDGFISAMPVILFSSIFLLIAYVPNIFGFK
                      **********************************************************

    COL             WDKGMEAILMKPYNYTMGLVAFLVAGTTAKSLTDSFNRKLESTNQINFISTMLAAMCGFL
    N315            WDKGMEAILMKPYNYTMGLVAFLVAGTTAKSLTDSFNRKLESTNQINFISTMLAAMCGFL
    NCTC8325        WDKGMEAILMKPYNYTMGLVAFLVAGTTAKSLTDSFNRKLESTNQINFISTMLAAMCGFL
    Newman          WDKGMEAILMKPYNYTMGLVAFLVAGTTAKSLTDSFNRKLESTNQINFISTMLAAMCGFL
    USA300_FPR3757  WDKGMEAILMKPYNYTMGLVAFLVAGTTAKSLTDSFNRKLESTNQINFISTMLAAMCGFL
                    ************************************************************

    COL             FLASDPAKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVKRNITIKMPKEVPPNISQVF
    N315            FLASDPAKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVKRNITIKMPKEVPPNISQVF
    NCTC8325        FLASDPAKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVKRNITIKMPKEVPPNISQVF
    Newman          FLASDPAKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVKRNITIKMPKEVPPNISQVF
    USA300_FPR3757  FLASDPAKDGGFLSAFMGTKGLLTAFLSAFVTVIVYNFCVKRNITIKMPKEVPPNISQVF
                    ************************************************************

    COL             KDLIPFSAVIIILYALDLVIRNSFKSNVAEGILKLFEPLFTAADGWIGVTIIFGAFALFW
    N315            KDLIPFSAVIIILYALDLVIRNSFKSNVAEGILKLFEPLFTAADGWIGVTIIFGAFALFW
    NCTC8325        KDLIPFSAVIIILYALDLVIRNSFKSNVAEGILKLFEPLFTAADGWIGVTIIFGAFALFW
    Newman          KDLIPFSAVIIILYALDLVIRNSFKSNVAEGILKLFEPLFTAADGWIGVTIIFGAFALFW
    USA300_FPR3757  KDLIPFSAVIIILYALDLVIRNSFKSNVAEGILKLFEPLFTAADGWIGVTIIFGAFALFW
                    ************************************************************

    COL             FVGIHGPSIVEPAIAAITYANIEANFKLLQAGEHADKIITSGTQMFIVTFGGTGATLVVP
    N315            FVGIHGPSIVEPAIAAITYANIEANFKLLQAGEHADKIITSGTQMFIVTFGGTGATLVVP
    NCTC8325        FVGIHGPSIVEPAIAAITYANIEANFKLLQAGEHADKIITSGTQMFIVTFGGTGATLVVP
    Newman          FVGIHGPSIVEPAIAAITYANIEANFKLLQAGEHADKIITSGTQMFIVTFGGTGATLVVP
    USA300_FPR3757  FVGIHGPSIVEPAIAAITYANIEANFKLLQAGEHADKIITSGTQMFIVTFGGTGATLVVP
                    ************************************************************

    COL             FMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKL
    N315            FMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKL
    NCTC8325        FMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKL
    Newman          FMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKL
    USA300_FPR3757  FMFMWMTKSKRNKAIGRASVVPTFFGVNEPILFGAPLVLNPVFFIPFVLAPIVNVWIFKL
                    ************************************************************

    COL             FVEVLGMNSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEI
    N315            FVEVLGINSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEI
    NCTC8325        FVEVLGMNSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEI
    Newman          FVEVLGMNSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEI
    USA300_FPR3757  FVEVLGMNSFSVNLPWTTPGPLGIIMGTGFGLWSFVLAITLIVVDIIIYYPFLKVYDSEI
                    ******:*****************************************************

    COL             LDEEEGRKESNSDLKEKVAANFDTKKADSILAASGVSDDAAKASNITEQTNVLVLCAGGG
    N315            LDEEEGRKESNSDLKEKVAANFDTKKADSILAASGVSDDAAKASNITEQTNVLVLCAGGG
    NCTC8325        LDEEEGRKESNSDLKEKVAANFDTKKADSILAASGVSDDAAKASNITEQTNVLVLCAGGG
    Newman          LDEEEGRKESNSDLKEKVAANFDTKKADSILAASGVSDDAAKASNITEQTNVLVLCAGGG
    USA300_FPR3757  LDEEEGRKESNSDLKEKVAANFDTKKADSILAASGVSDDAAKASNITEQTNVLVLCAGGG
                    ************************************************************

    COL             TSGLLANALNKAAEEYHVPVKAAAGGYGAHMDIMKEYQLIILAPQVASNYEDIKQDTDRL
    N315            TSGLLANALNKAAEEYHVPVKAAAGGYGAHMDIMKEYQLIILAPQVASNYEDIKQDTDRL
    NCTC8325        TSGLLANALNKAAEEYHVPVKAAAGGYGAHMDIMKEYQLIILAPQVASNYEDIKQDTDRL
    Newman          TSGLLANALNKAAEEYHVPVKAAAGGYGAHMDIMKEYQLIILAPQVASNYEDIKQDTDRL
    USA300_FPR3757  TSGLLANALNKAAEEYHVPVKAAAGGYGAHMDIMKEYQLIILAPQVASNYEDIKQDTDRL
                    ************************************************************

    COL             GIKLAKTQGAEYIKLTRDGQAALDFVQQQFEN
    N315            GIKLAKTQGAEYIKLTRDGQAALDFVQQQFEN
    NCTC8325        GIKLAKTQGAEYIKLTRDGQAALDFVQQQFEN
    Newman          GIKLAKTQGAEYIKLTRDGQAALDFVQQQFEN
    USA300_FPR3757  GIKLAKTQGAEYIKLTRDGQAALDFVQQQFEN
                    ********************************