From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005594000
  • symbol?: lacR
  • description?: lactose phosphotransferase system repressor

      descriptions from strain specific annotations:

    • lactose phosphotransferase system repressor
    • DeoR family transcriptional regulator
    • deoR-family regulatory protein
    • lactose PTS family porter repressor
  • strand?: -
  • coordinates?: 5732552..5733307
  • synteny block?: BlockID0043540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2188 (lacR)
    N315:
    SA1998 (lacR)
    NCTC8325:
    Newman:
    NWMN_2100 (lacR)
    USA300_FPR3757:
    04-02981:
    SA2981_2134 (lacR)
    08BA02176:
    C248_2235 (lacR)
    11819-97:
    MS7_2219 (lacR)
    71193:
    ST398NM01_2256
    ECT-R 2:
    ECTR2_2057
    ED133:
    SAOV_2243c
    ED98:
    SAAV_2257
    HO 5096 0412:
    SAEMRSA15_21010 (lacR)
    JH1:
    SaurJH1_2266
    JH9:
    SaurJH9_2227
    JKD6008:
    SAA6008_02237 (deoR)
    JKD6159:
    SAA6159_02107 (deoR)
    LGA251:
    SARLGA251_19910 (lacR)
    M013:
    M013TW_2164
    MRSA252:
    SAR2287 (lacR)
    MSHR1132:
    SAMSHR1132_20280
    MSSA476:
    SAS2097
    Mu3:
    SAHV_2180 (lacR)
    Mu50:
    SAV2196 (lacR)
    MW2:
    MW2122 (lacR)
    RF122:
    SAB2077c (lacR)
    ST398:
    SAPIG2256
    T0131:
    SAT0131_02370 (qoxC)
    TCH60:
    HMPREF0772_10995 (lacR)
    TW20:
    SATW20_23340 (lacR)
    USA300_TCH1516:
    USA300HOU_2189 (lacR)
    VC40:
    SAVC_09870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGI
    N315            ------------MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGI
    NCTC8325        MTHRLNKGGNFTLNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGI
    Newman          ------------MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGI
    USA300_FPR3757  ------------MNKHERLDEIAKLVNKKGTIRTNEIVEGLNVSDMTVRRDLIELENKGI
                                :***********************************************

    COL             LTKIHGGARSNSTFQYKEISHKEKHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELL
    N315            LTKIHGGARSNSTFQYKEISHKEKHTRQIAEKRYIARKAASLIEDGDTLFFGPGTTVELL
    NCTC8325        LTKIHGGARSNSTFQYKEISHKEKHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELL
    Newman          LTKIHGGARSNSTFQYKEISHKEKHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELL
    USA300_FPR3757  LTKIHGGARSNSTFQYKEISHKEKHTRQIAEKRFIAKKAASLIEDGDTLFFGPGTTVELL
                    *********************************:**:***********************

    COL             AEEVNHHTLTIITNCLPVYKILLEKQTAHFRVYLIGGEMRHITEAFVGEMANAMLEKLRF
    N315            AEEVNHHTLTIITNCLPVYKILLEKQTAHFRVYLIGGEMRHITEAFVGEMANAMLEKLRF
    NCTC8325        AEEVNHHTLTIITNCLPVYKILLEKQTAHFRVYLIGGEMRHITEAFVGEMANAMLEKLRF
    Newman          AEEVNHHTLTIITNCLPVYKILLEKQTAHFRVYLIGGEMRHITEAFVGEMANAMLEKLRF
    USA300_FPR3757  AEEVNHHTLTIITNCLPVYKILLEKQTAHFRVYLIGGEMRHITEAFVGEMANAMLEKLRF
                    ************************************************************

    COL             SKMFFSSNAVNKGAVMTSTLDEAYTQQLALSNSIEKYLLIDHTKVGKEDFTSFCQLNELT
    N315            SKMFFSSNAVNKGAVMTSTLDEAYTQQLALSNSIEKYLLIDHTKVGKEDFTSFCQLNELT
    NCTC8325        SKMFFSSNAVNKGAVMTSTLDEAYTQQLALSNSIEKYLLIDHTKVGKEDFTSFCQLNELT
    Newman          SKMFFSSNAVNKGAVMTSTLDEAYTQQLALSNSIEKYLLIDHTKVGKEDFTSFCQLNELT
    USA300_FPR3757  SKMFFSSNAVNKGAVMTSTLDEAYTQQLALSNSIEKYLLIDHTKVGKEDFTSFCQLNELT
                    ************************************************************

    COL             AVVMDYEDEEKVETIKTYIEVVD
    N315            AVVMDYEDEEKVETIKTYIEVVD
    NCTC8325        AVVMDYEDEEKVETIKTYIEVVD
    Newman          AVVMDYEDEEKVETIKTYIEVVD
    USA300_FPR3757  AVVMDYEDEEKVETIKTYIEVVD
                    ***********************