From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005606000
  • symbol?:
  • description?: oxidoreductase, aldo/keto reductase

      descriptions from strain specific annotations:

    • oxidoreductase, aldo/keto reductase
    • aldo/keto reductase oxidoreductase
    • aldo/keto reductase family protein
    • aldo/keto reductase family oxidoreductase
    • oxidoreductase, aldo/keto reductase family
    • Aldo/keto reductase
    • organophosphate reductase
    • morphine 6-dehydrogenase (Naloxone reductase)
    • Morphine 6-dehydrogenase
  • strand?: -
  • coordinates?: 5739093..5739941
  • synteny block?: BlockID0043650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2137
    08BA02176:
    C248_2240
    11819-97:
    MS7_2222
    71193:
    ST398NM01_2260
    ECT-R 2:
    ECTR2_2060
    ED133:
    SAOV_2245c
    ED98:
    SAAV_2260
    HO 5096 0412:
    SAEMRSA15_21050
    JH1:
    SaurJH1_2269
    JH9:
    SaurJH9_2230
    JKD6008:
    SAA6008_02240
    JKD6159:
    SAA6159_02112
    LGA251:
    SARLGA251_19940
    M013:
    M013TW_2167
    MRSA252:
    SAR2290
    MSHR1132:
    SAMSHR1132_20310
    MSSA476:
    SAS2101
    Mu3:
    SAHV_2184
    Mu50:
    SAV2200
    MW2:
    MW2127
    RF122:
    SAB2080c
    ST398:
    SAPIG2260
    T0131:
    SAT0131_02376 (folD)
    TCH60:
    HMPREF0772_10991 (akr5f)
    TW20:
    SATW20_23380
    USA300_TCH1516:
    USA300HOU_2193
    VC40:
    SAVC_09890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHIEISKDVKIPVLGFGVFQIPQEQTAEAVKEAIKAGYRHIDTAQSYLNETEVGQGIEA
    N315            MNHIEISKDVKIPVLGFGVFQIPQEQTAEAVKEAIKAGYRHIDTAQSYLNETEVGQGIEA
    NCTC8325        MNHIEISKDVKIPVLGFGVFQIPQEQTAEAVKEAIKAGYRHIDTAQSYLNETEVGQGIEA
    Newman          MNHIEISKDVKIPVLGFGVFQIPQEQTAEAVKEAIKAGYRHIDTAQSYLNETEVGQGIEA
    USA300_FPR3757  MNHIEISKDVKIPVLGFGVFQIPQEQTAEAVKEAIKAGYRHIDTAQSYLNETEVGQGIEA
                    ************************************************************

    COL             SGIDRSELFITTKVWIENVNYEDTIKSIERSLQRLNLDYLDLVLIHQPYNDVYGSWRALE
    N315            SGIDRSELFITTKVWIENVNYEDTIKSIERSLQRLNLDYLDLVLIHQPYNDVYGSWRALE
    NCTC8325        SGIDRSELFITTKVWIENVNYEDTIKSIERSLQRLNLDYLDLVLIHQPYNDVYGSWRALE
    Newman          SGIDRSELFITTKVWIENVNYEDTIKSIERSLQRLNLDYLDLVLIHQPYNDVYGSWRALE
    USA300_FPR3757  SGIDRSELFITTKVWIENVNYEDTIKSIERSLQRLNLDYLDLVLIHQPYNDVYGSWRALE
                    ************************************************************

    COL             ELKENGKIKAIGVSNFGVDRIVDLGIHNQIQPQVNQIEINPFHQQEEQVAALQQENVVVE
    N315            ELKENGKIKAIGVSNFGVDRIVDLGIHNQIQPQVNQIEINPFHQQEEQVAALQQENVVVE
    NCTC8325        ELKENGKIKAIGVSNFGVDRIVDLGIHNQIQPQVNQIEINPFHQQEEQVAALQQENVVVE
    Newman          ELKENGKIKAIGVSNFGVDRIVDLGIHNQIQPQVNQIEINPFHQQEEQVAALQQENVVVE
    USA300_FPR3757  ELKENGKIKAIGVSNFGVDRIVDLGIHNQIQPQVNQIEINPFHQQEEQVAALQQENVVVE
                    ************************************************************

    COL             AWAPFAEGKNQLFQNQLLQAIADKYNKSIAQVILRWLVERDIVVLAKSVNPERMAQNLDI
    N315            AWAPFAEGKNQLFQNQLLQAIADKYNKSIAQVILRWLVERDIVVLAKSVNPERMAQNLDI
    NCTC8325        AWAPFAEGKNQLFQNQLLQAIADKYNKSIAQVILRWLVERDIVVLAKSVNPERMAQNLDI
    Newman          AWAPFAEGKNQLFQNQLLQAIADKYNKSIAQVILRWLVERDIVVLAKSVNPERMAQNLDI
    USA300_FPR3757  AWAPFAEGKNQLFQNQLLQAIADKYNKSIAQVILRWLVERDIVVLAKSVNPERMAQNLDI
                    ************************************************************

    COL             FDFELTEEDKQQIATLEESNSQFFSHADPEMIKALTSRELDV
    N315            FDFELTEEDKQQIATLEESNSQFFSHADPEMIKALTSRELDV
    NCTC8325        FDFELTEEDKQQIATLEESNSQFFSHADPEMIKALTSRELDV
    Newman          FDFELTEEDKQQIATLEESNSQFFSHADPEMIKALTSRELDV
    USA300_FPR3757  FDFELTEEDKQQIATLEESNSQFFSHADPEMIKALTSRELDV
                    ******************************************