From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2001 [new locus tag: SA_RS11520 ]
  • pan locus tag?: SAUPAN005606000
  • symbol: SA2001
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2001 [new locus tag: SA_RS11520 ]
  • symbol: SA2001
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2271851..2272699
  • length: 849
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAATCATATTGAAATAAGTAAAGATGTAAAGATACCAGTATTAGGTTTCGGAGTATTT
    CAAATTCCTCAAGAACAAACAGCAGAAGCGGTTAAAGAAGCAATTAAAGCGGGTTATAGA
    CATATTGATACAGCACAAAGTTATTTAAATGAAACTGAAGTAGGTCAAGGTATTGAAGCT
    TCAGGTATTGATAGAAGTGAACTATTCATTACGACTAAAGTATGGATTGAAAATGTTAAC
    TATGAAGATACTATCAAATCAATCGAACGATCATTACAACGATTAAATTTGGACTATCTT
    GATCTAGTGCTTATTCACCAACCTTACAATGACGTATATGGCTCATGGCGTGCATTAGAA
    GAGTTAAAAGAAAATGGTAAAATTAAAGCAATCGGTGTATCTAACTTCGGCGTTGATCGA
    ATTGTAGATTTAGGTATTCACAATCAAATTCAACCACAAGTGAACCAAATAGAAATTAAT
    CCATTCCATCAACAAGAAGAACAAGTTGCAGCACTTCAACAAGAAAATGTTGTGGTAGAA
    GCTTGGGCACCATTTGCAGAAGGTAAAAATCAATTATTCCAAAATCAATTGTTGCAGGCC
    ATTGCAGATAAATACAACAAATCAATTGCACAAGTTATTTTACGCTGGTTAGTAGAACGT
    GACATTGTTGTACTCGCAAAATCAGTGAATCCAGAACGTATGGCTCAAAACTTAGATATA
    TTTGATTTTGAACTTACAGAAGAAGATAAACAACAAATTGCGACATTAGAAGAAAGTAAT
    AGCCAATTTTTCTCACATGCTGATCCAGAGATGATTAAAGCACTTACAAGCAGAGAATTA
    GATGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    849

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2001 [new locus tag: SA_RS11520 ]
  • symbol: SA2001
  • description: hypothetical protein
  • length: 282
  • theoretical pI: 4.38261
  • theoretical MW: 32202
  • GRAVY: -0.336525

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    voltage-dependent potassium channel beta subunit (TIGR01293; HMM-score: 47.3)
  • TheSEED:  
    Oxidoreductase, aldo/keto reductase family 
  • PFAM:
    no clan definedAldo_ket_red; Aldo/keto reductase family (PF00248; HMM-score: 180.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA1533(ackA)acetate kinase  [1] (data from MRSA252)
    SA1984(asp23)alkaline shock protein 23  [1] (data from MRSA252)
    SA1517(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    SA0545(eutD)phosphotransacetylase  [1] (data from MRSA252)
    SA1029(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    SA0727(gap)glyceraldehyde-3-phosphate dehydrogenase  [1] (data from MRSA252)
    SA1959(glmS)glucosamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA0943-1(pdhA)pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA0218(pflB)formate acetyltransferase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2033(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SA0014(rplI)50S ribosomal protein L9  [1] (data from MRSA252)
    SA2017(rplM)50S ribosomal protein L13  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA2022(rplQ)50S ribosomal protein L17  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA1099(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    SA2041(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    SA2016(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SA1414(rpsT)30S ribosomal protein S20  [1] (data from MRSA252)
    SA0708(secA)preprotein translocase subunit SecA  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0342hypothetical protein  [1] (data from MRSA252)
    SA0627hypothetical protein  [1] (data from MRSA252)
    SA1528hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.274
    • Ymax_pos: 31
    • Cmax: 0.274
    • Cmax_pos: 31
    • Smax: 0.485
    • Smax_pos: 27
    • Smean: 0.175
    • D: 0.235
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNHIEISKDVKIPVLGFGVFQIPQEQTAEAVKEAIKAGYRHIDTAQSYLNETEVGQGIEASGIDRSELFITTKVWIENVNYEDTIKSIERSLQRLNLDYLDLVLIHQPYNDVYGSWRALEELKENGKIKAIGVSNFGVDRIVDLGIHNQIQPQVNQIEINPFHQQEEQVAALQQENVVVEAWAPFAEGKNQLFQNQLLQAIADKYNKSIAQVILRWLVERDIVVLAKSVNPERMAQNLDIFDFELTEEDKQQIATLEESNSQFFSHADPEMIKALTSRELDV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]