From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2002 [new locus tag: SA_RS11525 ]
  • pan locus tag?: SAUPAN005608000
  • symbol: SA2002
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2002 [new locus tag: SA_RS11525 ]
  • symbol: SA2002
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2272769..2273185
  • length: 417
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAACTAAAGAAGTCGTAGCGCTCATGAATATATCTCAAGACACTTTAAGATATTAT
    GAAAAGGTTGGTGTGATTCCACCCGTTAATCGAGATGAAAATGGATATAGAATATATAAT
    GATAGTGATTTAAATTGGATTTATTTAGTGAAAAATTTGCGAAATGCAGGCGTCAGTATT
    GAATCGCTTATCGAATTTTGTAGATTAGCGCAGCTTCCTAAAAATAAAAATATTCAAACA
    CAGCAAAAGCAAATTTTAAATAAGCAACTCGAAGAATTAAATGAAAACTTAAAGACAATT
    CATGATGCGAGAGATTTACTAAAATATAAAATTGATAATTATGATAATCATATTGCTAAA
    ATCAATGCTAGTGATAATCATGATGACAATGTTGAACGTCTTTGGGAGAGAAAGTAA
    60
    120
    180
    240
    300
    360
    417

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2002 [new locus tag: SA_RS11525 ]
  • symbol: SA2002
  • description: hypothetical protein
  • length: 138
  • theoretical pI: 7.59288
  • theoretical MW: 16343.4
  • GRAVY: -0.818841

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsCu(I)-responsive transcriptional regulator (TIGR02044; HMM-score: 63)
    Signal transductionRegulatory functionsDNA interactionsZn(II)-responsive transcriptional regulator (TIGR02043; HMM-score: 58.5)
    Signal transductionRegulatory functionsDNA interactionsCd(II)/Pb(II)-responsive transcriptional regulator (TIGR02047; HMM-score: 44.5)
    Cellular processesCellular processesDetoxificationHg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
    Signal transductionRegulatory functionsDNA interactionsHg(II)-responsive transcriptional regulator (TIGR02051; HMM-score: 43)
    Cellular processesCellular processesDetoxificationmercuric resistence transcriptional repressor protein MerD (TIGR02054; HMM-score: 28.8)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsplasmid partitioning protein RepA (TIGR03453; HMM-score: 12)
  • TheSEED:  
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsCobalt-zinc-cadmium resistance Transcriptional regulator, MerR family 
  • PFAM:
    HTH (CL0123) MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 61.5)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 49.2)
    MerR-DNA-bind; MerR, DNA binding (PF09278; HMM-score: 15.7)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 15.3)
    no clan definedNop25; Nucleolar protein 12 (25kDa) (PF09805; HMM-score: 14.3)
    Serine_rich; Serine rich protein interaction domain (PF08824; HMM-score: 14.1)
    SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 13.8)
    Peptidase_CA (CL0125) Phytochelatin; Phytochelatin synthase (PF05023; HMM-score: 13.7)
    no clan definedDASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.122
    • Ymax_pos: 32
    • Cmax: 0.119
    • Cmax_pos: 32
    • Smax: 0.177
    • Smax_pos: 19
    • Smean: 0.111
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSIESLIEFCRLAQLPKNKNIQTQQKQILNKQLEELNENLKTIHDARDLLKYKIDNYDNHIAKINASDNHDDNVERLWERK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]