From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005608000
  • symbol?:
  • description?: MerR family transcriptional regulator

      descriptions from strain specific annotations:

    • MerR family transcriptional regulator
    • transcriptional regulator MerR family protein
    • merR family regulatory family protein
    • MerR family regulatory protein
    • MerR family transcription regulator-like protein
    • transcriptional regulator, MerR family
  • strand?: -
  • coordinates?: 5740011..5740427
  • synteny block?: BlockID0043670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2138
    08BA02176:
    C248_2242
    11819-97:
    MS7_2223
    71193:
    ST398NM01_2261
    ECT-R 2:
    ECTR2_2061
    ED133:
    SAOV_2246c
    ED98:
    SAAV_2261
    HO 5096 0412:
    SAEMRSA15_21060
    JH1:
    SaurJH1_2270
    JH9:
    SaurJH9_2231
    JKD6008:
    SAA6008_02241
    JKD6159:
    SAA6159_02113
    LGA251:
    SARLGA251_19950
    M013:
    M013TW_2168
    MRSA252:
    SAR2291
    MSHR1132:
    SAMSHR1132_20320
    MSSA476:
    SAS2102
    Mu3:
    SAHV_2185
    Mu50:
    SAV2201
    MW2:
    MW2128
    RF122:
    SAB2081c
    ST398:
    SAPIG2261
    T0131:
    SAT0131_02377
    TCH60:
    HMPREF0772_10990
    TW20:
    SATW20_23390
    USA300_TCH1516:
    USA300HOU_2195
    VC40:
    SAVC_09895

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSI
    N315            MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSI
    NCTC8325        MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSI
    Newman          MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSI
    USA300_FPR3757  MKTKEVVALMNISQDTLRYYEKVGVIPPVNRDENGYRIYNDSDLNWIYLVKNLRNAGVSI
                    ************************************************************

    COL             ESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDARDLLQYKIDNYDNHIAK
    N315            ESLIEFCRLAQLPKNKNIQTQQKQILNKQLEELNENLKTIHDARDLLKYKIDNYDNHIAK
    NCTC8325        ESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDARDLLQYKIDNYDNHIAK
    Newman          ESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDARDLLQYKIDNYDNHIAK
    USA300_FPR3757  ESLIEFCRLAQLPKNENIQAQQKQILNKQLEELNENLKTIHDVRDLLQYKIDNYDNHIAK
                    ***************:***:**********************.****:************

    COL             INASDNYDDNVERLWERK
    N315            INASDNHDDNVERLWERK
    NCTC8325        INASDNYDDNVERLWERK
    Newman          INASDNYDDNVERLWERK
    USA300_FPR3757  INASDNYDDNVERLWERK
                    ******:***********