From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005677000
  • symbol?: rpsK
  • description?: 30S ribosomal protein S11

      descriptions from strain specific annotations:

    • 30S ribosomal protein S11
    • 30S ribosomal protein S11 (BS11)
  • strand?: -
  • coordinates?: 5798802..5799191
  • synteny block?: BlockID0044230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2214 (rpsK)
    N315:
    SA2024 (rpsK)
    NCTC8325:
    Newman:
    NWMN_2127 (rpsK)
    USA300_FPR3757:
    04-02981:
    SA2981_2163 (rpsK)
    08BA02176:
    C248_2261 (rpsK)
    11819-97:
    MS7_2245 (rpsK)
    71193:
    ST398NM01_2278
    ECT-R 2:
    ECTR2_2087
    ED133:
    SAOV_2263c
    ED98:
    SAAV_2287 (rpsK)
    HO 5096 0412:
    SAEMRSA15_21240 (rpsK)
    JH1:
    SaurJH1_2293
    JH9:
    SaurJH9_2252
    JKD6008:
    SAA6008_02262 (rpsK)
    JKD6159:
    SAA6159_02132 (rpsK)
    LGA251:
    SARLGA251_20110 (rpsK)
    M013:
    M013TW_2185
    MRSA252:
    SAR2310 (rpsK)
    MSHR1132:
    SAMSHR1132_20510
    MSSA476:
    SAS2116
    Mu3:
    SAHV_2209 (rpsK)
    Mu50:
    SAV2225 (rpsK)
    MW2:
    MW2144 (rpsK)
    RF122:
    SAB2098c (rpsK)
    ST398:
    SAPIG2278 (rpsK)
    T0131:
    SAT0131_02398 (ptsH)
    TCH60:
    HMPREF0772_10973 (rpsK)
    TW20:
    SATW20_23590 (rpsK)
    USA300_TCH1516:
    USA300HOU_2216 (rpsK)
    VC40:
    SAVC_09995

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARKQVSRKRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTP
    N315            MARKQVSRKRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTP
    NCTC8325        MARKQVSRKRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTP
    Newman          MARKQVSRKRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTP
    USA300_FPR3757  MARKQVSRKRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTP
                    ************************************************************

    COL             FAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNG
    N315            FAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNG
    NCTC8325        FAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNG
    Newman          FAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNG
    USA300_FPR3757  FAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNG
                    ************************************************************

    COL             CRPPKRRRV
    N315            CRPPKRRRV
    NCTC8325        CRPPKRRRV
    Newman          CRPPKRRRV
    USA300_FPR3757  CRPPKRRRV
                    *********