From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005682000
  • symbol?: secY
  • description?: preprotein translocase subunit SecY

      descriptions from strain specific annotations:

    • preprotein translocase subunit SecY
    • Preprotein translocase secY subunit
    • Sec family Type I general secretory pathway preprotein translocase SecY_1
    • preprotein translocase, SecY subunit
    • SecY protein
  • strand?: -
  • coordinates?: 5800823..5802153
  • synteny block?: BlockID0044280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2219 (secY)
    N315:
    SA2028 (secY)
    NCTC8325:
    Newman:
    NWMN_2132 (secY)
    USA300_FPR3757:
    04-02981:
    SA2981_2168 (secY)
    08BA02176:
    C248_2266 (secY)
    11819-97:
    MS7_2250 (secY)
    71193:
    ST398NM01_2283
    ECT-R 2:
    ECTR2_2092 (secY)
    ED133:
    SAOV_2267c
    ED98:
    SAAV_2292 (secY)
    HO 5096 0412:
    SAEMRSA15_21290 (secY)
    JH1:
    SaurJH1_2298 (secY)
    JH9:
    SaurJH9_2257 (secY)
    JKD6008:
    SAA6008_02267 (secY_1)
    JKD6159:
    SAA6159_02137 (secY_1)
    LGA251:
    SARLGA251_20160 (secY)
    M013:
    M013TW_2190
    MRSA252:
    SAR2315 (secY)
    MSHR1132:
    SAMSHR1132_20560
    MSSA476:
    SAS2121 (secY)
    Mu3:
    SAHV_2214 (secY)
    Mu50:
    SAV2230 (secY)
    MW2:
    MW2149 (secY)
    RF122:
    SAB2102c (secY)
    ST398:
    SAPIG2283
    T0131:
    SAT0131_02403
    TCH60:
    HMPREF0772_10968 (secY2)
    TW20:
    SATW20_23640 (secY)
    USA300_TCH1516:
    USA300HOU_2221 (secY)
    VC40:
    SAVC_10020 (secY)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIQTLVNFFRTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPAAFDNPQGSQGATELLNTF
    N315            MIQTLVNFFRTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPAAFDNPQGSQGATELLNTF
    NCTC8325        MIQTLVNFFRTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPAAFDNPQGSQGATELLNTF
    Newman          MIQTLVNFFRTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPAAFDNPQGSQGATELLNTF
    USA300_FPR3757  MIQTLVNFFRTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPAAFDNPQGSQGATELLNTF
                    ************************************************************

    COL             GGGALKRFSIFAMGIVPYITASIVMQLLQMDIVPKFSEWAKQGEVGRRKLNNVTRYLAIS
    N315            GGGALKRFSIFAMGIVPYITASIVMQLLQMDIVPKFSEWAKQGEVGRRKLNNVTRYLAIS
    NCTC8325        GGGALKRFSIFAMGIVPYITASIVMQLLQMDIVPKFSEWAKQGEVGRRKLNNVTRYLAIS
    Newman          GGGALKRFSIFAMGIVPYITASIVMQLLQMDIVPKFSEWAKQGEVGRRKLNNVTRYLAIS
    USA300_FPR3757  GGGALKRFSIFAMGIVPYITASIVMQLLQMDIVPKFSEWAKQGEVGRRKLNNVTRYLAIS
                    ************************************************************

    COL             LAFIQSIGMAFQFNNYLKGALIINQSIMSYLLIALVLTAGTAFLIWLGDQITQFGVGNGI
    N315            LAFIQSIGMAFQFNNYLKGALIINQSIMSYLLIALVLTAGTAFLIWLGDQITQFGVGNGI
    NCTC8325        LAFIQSIGMAFQFNNYLKGALIINQSIMSYLLIALVLTAGTAFLIWLGDQITQFGVGNGI
    Newman          LAFIQSIGMAFQFNNYLKGALIINQSIMSYLLIALVLTAGTAFLIWLGDQITQFGVGNGI
    USA300_FPR3757  LAFIQSIGMAFQFNNYLKGALIINQSIMSYLLIALVLTAGTAFLIWLGDQITQFGVGNGI
                    ************************************************************

    COL             SIIIFAGILSTLPASLIQFGQTAFVGQEDTSLAWLKVLGLLVSLILLTVGAIYVLEAVRK
    N315            SIIIFAGILSTLPASLIQFGQTAFVGQEDTSLAWLKVLGLLVSLILLTVGAIYVLEAVRK
    NCTC8325        SIIIFAGILSTLPASLIQFGQTAFVGQEDTSLAWLKVLGLLVSLILLTVGAIYVLEAVRK
    Newman          SIIIFAGILSTLPASLIQFGQTAFVGQEDTSLAWLKVLGLLVSLILLTVGAIYVLEAVRK
    USA300_FPR3757  SIIIFAGILSTLPASLIQFGQTAFVGQEDTSLAWLKVLGLLVSLILLTVGAIYVLEAVRK
                    ************************************************************

    COL             IPIQYAKKQTAQRLGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFYPDKEWAQNIA
    N315            IPIQYAKKQTAQRLGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFYPDKEWAQNIA
    NCTC8325        IPIQYAKKQTAQRLGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFYPDKEWAQNIA
    Newman          IPIQYAKKQTAQRLGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFYPDKEWAQNIA
    USA300_FPR3757  IPIQYAKKQTAQRLGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFYPDKEWAQNIA
                    ************************************************************

    COL             NAANPSSNVGMVVYIVLIILFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYIT
    N315            NAANPSSNVGMVVYIVLIILFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYIT
    NCTC8325        NAANPSSNVGMVVYIVLIILFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYIT
    Newman          NAANPSSNVGMVVYIVLIILFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYIT
    USA300_FPR3757  NAANPSSNVGMVVYIVLIILFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYIT
                    ************************************************************

    COL             KVLYRLTFVGSIFLAVISILPILATKFMGLPQSIQIGGTSLLIVIGVAIETMKSLEAQVS
    N315            KVLYRLTFVGSIFLAVISILPILATKFMGLPQSIQIGGTSLLIVIGVAIETMKSLEAQVS
    NCTC8325        KVLYRLTFVGSIFLAVISILPILATKFMGLPQSIQIGGTSLLIVIGVAIETMKSLEAQVS
    Newman          KVLYRLTFVGSIFLAVISILPILATKFMGLPQSIQIGGTSLLIVIGVAIETMKSLEAQVS
    USA300_FPR3757  KVLYRLTFVGSIFLAVISILPILATKFMGLPQSIQIGGTSLLIVIGVAIETMKSLEAQVS
                    ************************************************************

    COL             QKEYKGFGGR
    N315            QKEYKGFGGR
    NCTC8325        QKEYKGFGGR
    Newman          QKEYKGFGGR
    USA300_FPR3757  QKEYKGFGGR
                    **********