From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005690000
  • symbol?: rplE
  • description?: 50S ribosomal protein L5

      descriptions from strain specific annotations:

    • 50S ribosomal protein L5
    • 50S ribosomal protein L5 (BL6)
  • strand?: -
  • coordinates?: 5804932..5805423
  • synteny block?: BlockID0044360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2227 (rplE)
    N315:
    SA2035 (rplE)
    NCTC8325:
    Newman:
    NWMN_2140 (rplE)
    USA300_FPR3757:
    04-02981:
    SA2981_2176 (rplE)
    08BA02176:
    C248_2274 (rplE)
    11819-97:
    MS7_2258 (rplE)
    71193:
    ST398NM01_2291
    ECT-R 2:
    ECTR2_2100
    ED133:
    SAOV_2275c
    ED98:
    SAAV_2300 (rplE)
    HO 5096 0412:
    SAEMRSA15_21370 (rplE)
    JH1:
    SaurJH1_2306 (rplE)
    JH9:
    SaurJH9_2265 (rplE)
    JKD6008:
    SAA6008_02275 (rplE)
    JKD6159:
    SAA6159_02145 (rplE)
    LGA251:
    SARLGA251_20240 (rplE)
    M013:
    M013TW_2197
    MRSA252:
    SAR2323 (rplE)
    MSHR1132:
    SAMSHR1132_20640
    MSSA476:
    SAS2129 (rplE)
    Mu3:
    SAHV_2222 (rplE)
    Mu50:
    SAV2238 (rplE)
    MW2:
    MW2157 (rplE)
    RF122:
    SAB2110c (rplE)
    ST398:
    SAPIG2291
    T0131:
    SAT0131_02411 (pdhD)
    TCH60:
    HMPREF0772_10960 (rplE)
    TW20:
    SATW20_23720 (rplE)
    USA300_TCH1516:
    USA300HOU_2229 (rplE)
    VC40:
    SAVC_10060 (rplE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELI
    N315            MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELI
    NCTC8325        MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELI
    Newman          MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELI
    USA300_FPR3757  MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELI
                    ************************************************************

    COL             TGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKK
    N315            TGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKK
    NCTC8325        TGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKK
    Newman          TGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKK
    USA300_FPR3757  TGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKK
                    ************************************************************

    COL             AFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK
    N315            AFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK
    NCTC8325        AFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK
    Newman          AFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK
    USA300_FPR3757  AFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK
                    ***********************************************************