From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005696000
  • symbol?: rpsC
  • description?: 30S ribosomal protein S3
  • strand?: -
  • coordinates?: 5807174..5807827
  • synteny block?: BlockID0044420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2233 (rpsC)
    N315:
    SA2041 (rpsC)
    NCTC8325:
    Newman:
    NWMN_2146 (rpsC)
    USA300_FPR3757:
    04-02981:
    SA2981_2182 (rpsC)
    08BA02176:
    C248_2280 (rpsC)
    11819-97:
    MS7_2264 (rpsC)
    71193:
    ST398NM01_2297
    ECT-R 2:
    ECTR2_2106 (rpsC)
    ED133:
    SAOV_2281c
    ED98:
    SAAV_2306 (rpsC)
    HO 5096 0412:
    SAEMRSA15_21430 (rpsC)
    JH1:
    SaurJH1_2312 (rpsC)
    JH9:
    SaurJH9_2271 (rpsC)
    JKD6008:
    SAA6008_02281 (rpsC)
    JKD6159:
    SAA6159_02151 (rpsC)
    LGA251:
    SARLGA251_20300 (rpsC)
    M013:
    M013TW_2203
    MRSA252:
    SAR2329 (rpsC)
    MSHR1132:
    SAMSHR1132_20700
    MSSA476:
    SAS2135 (rpsC)
    Mu3:
    SAHV_2228 (rpsC)
    Mu50:
    SAV2244 (rpsC)
    MW2:
    MW2163 (rpsC)
    RF122:
    SAB2116c (rpsC)
    ST398:
    SAPIG2297 (rpsC)
    T0131:
    SAT0131_02417
    TCH60:
    HMPREF0772_10954 (rpsC)
    TW20:
    SATW20_23780 (rpsC)
    USA300_TCH1516:
    USA300HOU_p2
    VC40:
    SAVC_10090 (rpsC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAA
    N315            MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAA
    NCTC8325        MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAA
    Newman          MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAA
    USA300_FPR3757  MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAA
                    ************************************************************

    COL             NRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIA
    N315            NRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIA
    NCTC8325        NRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIA
    Newman          NRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIA
    USA300_FPR3757  NRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIA
                    ************************************************************

    COL             RQLENRASFRRVQKQAITRAMKLGAKGIKTQISGRLGGADIARAEQYSEGTVPLHTLRAD
    N315            RQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRAD
    NCTC8325        RQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRAD
    Newman          RQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRAD
    USA300_FPR3757  RQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRAD
                    *******************************:****************************

    COL             IDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK
    N315            IDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK
    NCTC8325        IDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK
    Newman          IDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK
    USA300_FPR3757  IDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK
                    *************************************