From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005699000
  • symbol?: rplB
  • description?: 50S ribosomal protein L2
  • strand?: -
  • coordinates?: 5808578..5809411
  • synteny block?: BlockID0044450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2236 (rplB)
    N315:
    SA2044 (rplB)
    NCTC8325:
    Newman:
    NWMN_2149 (rplB)
    USA300_FPR3757:
    04-02981:
    SA2981_2185 (rplB)
    08BA02176:
    C248_2283 (rplB)
    11819-97:
    MS7_2267 (rplB)
    71193:
    ST398NM01_2300
    ECT-R 2:
    ECTR2_2109 (rplB)
    ED133:
    SAOV_2284c
    ED98:
    SAAV_2309 (rplB)
    HO 5096 0412:
    SAEMRSA15_21460 (rplB)
    JH1:
    SaurJH1_2315 (rplB)
    JH9:
    SaurJH9_2274 (rplB)
    JKD6008:
    SAA6008_02284 (rplB)
    JKD6159:
    SAA6159_02154 (rplB)
    LGA251:
    SARLGA251_20330 (rplB)
    M013:
    M013TW_2206
    MRSA252:
    SAR2332 (rplB)
    MSHR1132:
    SAMSHR1132_20730
    MSSA476:
    SAS2138 (rplB)
    Mu3:
    SAHV_2231 (rplB)
    Mu50:
    SAV2247 (rplB)
    MW2:
    MW2166 (rplB)
    RF122:
    SAB2119c (rplB)
    ST398:
    SAPIG2300 (rplB)
    T0131:
    SAT0131_02420
    TCH60:
    HMPREF0772_10951 (rplB)
    TW20:
    SATW20_23810 (rplB)
    USA300_TCH1516:
    USA300HOU_2805
    VC40:
    SAVC_10105 (rplB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKR
    N315            MAIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKR
    NCTC8325        MAIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKR
    Newman          MAIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKR
    USA300_FPR3757  MAIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKR
                    ************************************************************

    COL             QYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGA
    N315            QYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGA
    NCTC8325        QYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGA
    Newman          QYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGA
    USA300_FPR3757  QYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGA
                    ************************************************************

    COL             EADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGE
    N315            EADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGE
    NCTC8325        EADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGE
    Newman          EADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGE
    USA300_FPR3757  EADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGE
                    ************************************************************

    COL             VRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
    N315            VRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
    NCTC8325        VRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
    Newman          VRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
    USA300_FPR3757  VRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAP
                    ************************************************************

    COL             IGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK
    N315            IGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK
    NCTC8325        IGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK
    Newman          IGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK
    USA300_FPR3757  IGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK
                    *************************************