From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005708000
  • symbol?:
  • description?: N-acetyltransferase GCN5

      descriptions from strain specific annotations:

    • N-acetyltransferase GCN5
    • acetyltransferase (GNAT) family protein
    • GCN5-related N-acetyltransferase
    • Acetyltransferase
    • acetyltransferase family protein
    • GNAT family acetyltransferase
  • strand?: +
  • coordinates?: 5816017..5817002
  • synteny block?: BlockID0044540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2193
    08BA02176:
    C248_2291
    11819-97:
    MS7_2275
    71193:
    ST398NM01_2308
    ECT-R 2:
    ECTR2_2117
    ED133:
    SAOV_2293
    ED98:
    SAAV_2317
    HO 5096 0412:
    SAEMRSA15_21540
    JH1:
    SaurJH1_2323
    JH9:
    SaurJH9_2282
    JKD6008:
    SAA6008_02292
    JKD6159:
    SAA6159_02162
    LGA251:
    SARLGA251_20410
    M013:
    M013TW_2214
    MRSA252:
    SAR2340
    MSHR1132:
    SAMSHR1132_20810
    MSSA476:
    SAS2146
    Mu3:
    SAHV_2239
    Mu50:
    SAV2255
    MW2:
    MW2174
    RF122:
    SAB2127
    ST398:
    SAPIG2308
    T0131:
    SAT0131_02428
    TCH60:
    HMPREF0772_10943
    TW20:
    SATW20_23890
    USA300_TCH1516:
    USA300HOU_2237
    VC40:
    SAVC_10145

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------------MSIVQLYDITQIKSFIEHSNYESASYLYKL
    N315            MYCNMLISLLTFISVEILYNKSNKKYGGNDMSIVQLYDITQIKSFIEHSNYESASYLYKL
    NCTC8325        ------------------------------MSIVQLYDITQIKSFIEHSNYESASYLYKL
    Newman          ------------------------------MSIVQLYDITQIKSFIEHSNYESASYLYKL
    USA300_FPR3757  ------------------------------MSIVQLYDITQIKSFIEHSNYESASYLYKL
                                                  ******************************

    COL             PQQYNEIDVLITDAIESPGVFSIKENDSIKAIILSFAYDKNKFKVIGPFVADNYVLSVDT
    N315            PQQYNEIDVLITDAIESPGVFSIKENDSIKAIILSFAYDKNKFKVIGPFVADNYVLSVDT
    NCTC8325        PQQYNEIDVLITDAIESPGVFSIKENDSIKAIILSFAYDKNKFKVIGPFVADNYVLSVDT
    Newman          PQQYNEIDVLITDAIESPGVFSIKENDSIKAIILSFAYDKNKFKVIGPFVADNYVLSVDT
    USA300_FPR3757  PQQYNEIDVLITDAIESPGVFSIKENDSIKAIILSFAYDKNKFKVIGPFVADNYVLSVDT
                    ************************************************************

    COL             FETLFKAMTSNQPDDAVFNFSFEEGIQQYKPLMKVIQASYNFTDYYIEARTRLEEDMHQP
    N315            FETLFKAMTSNQPDDAVFNFSFEEGIQQYKPLMKVIQASYNFTDYYIEARTRLEEDMHQP
    NCTC8325        FETLFKAMTSNQPDDAVFNFSFEEGIQQYKPLMKVIQASYNFTDYYIEARTRLEEDMHQP
    Newman          FETLFKAMTSNQPDDAVFNFSFEEGIQQYKPLMKVIQASYNFTDYYIEARTRLEEDMHQP
    USA300_FPR3757  FETLFKAMTSNQPDDAVFNFSFEEGIQQYKPLMKVIQASYNFTDYYIEARTRLEEDMHQP
                    ************************************************************

    COL             NIIPYHKGFYRAFSKLHTTTFKYQAQSPQDIIDSLDDHHHLFLFVSEGLLKGYLYLEIDS
    N315            NIIPYHKGFYRAFSKLHTTTFKYQAQSPQDIIDSLDDHHHLFLFVSEGLLKGYLYLEIDS
    NCTC8325        NIIPYHKGFYRAFSKLHTTTFKYQAQSPQDIIDSLDDHHHLFLFVSEGLLKGYLYLEIDS
    Newman          NIIPYHKGFYRAFSKLHTTTFKYQAQSPQDIIDSLDDHHHLFLFVSEGLLKGYLYLEIDS
    USA300_FPR3757  NIIPYHKGFYRAFSKLHTTTFKYQAQSPQDIIDSLDDHHHLFLFVSEGLLKGYLYLEIDS
                    ************************************************************

    COL             QQSIAEIKYFSSHVDYRLKGIAFELLAYALQYAFDNFDIRKVYFKIRNKNNKLIERFNGL
    N315            QQSIAEIKYFSSHVDYRLKGIAFELLAYALQYAFDNFDIRKVYFKIRNKNNKLIERFNGL
    NCTC8325        QQSIAEIKYFSSHVDYRLKGIAFELLAYALQYAFDNFDIRKVYFKIRNKNNKLIERFNGL
    Newman          QQSIAEIKYFSSHVDYRLKGIAFELLAYALQYAFDNFDIRKVYFKIRNKNNKLIERFNGL
    USA300_FPR3757  QQSIAEIKYFSSHVDYRLKGIAFELLAYALQYAFDNFDIRKVYFKIRNKNNKLIERFNGL
                    ************************************************************

    COL             GFHINYEYIKFKFESRNVKDQTIPE
    N315            GFHINYEYIKFKFESRNVKDQTIPE
    NCTC8325        GFHINYEYIKFKFESRNVKDQTIPE
    Newman          GFHINYEYIKFKFESRNVKDQTIPE
    USA300_FPR3757  GFHINYEYIKFKFESRNVKDQTIPE
                    *************************