From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005731000
  • symbol?: moaD
  • description?: molybdopterin synthase small subunit

      descriptions from strain specific annotations:

    • molybdopterin synthase small subunit
    • molybdopterin converting factor subunit 1
    • molybdopterin converting factor, subunit 1
    • putative molybdopterin-synthase small subunit
    • Mmolybdopterin converting factor, subunit 1
    • Molybdopterin synthase sulfur carrier subunit
    • molybdenum cofactor biosynthesis protein MoaD
    • molybdopterin converting factor small subunit
    • molybdenum cofactor biosynthesis protein small subunit
    • molybdopterin converting factor, small subunit
  • strand?: -
  • coordinates?: 5832488..5832721
  • synteny block?: BlockID0044770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2263 (moaD)
    N315:
    SA2065 (moaD)
    NCTC8325:
    Newman:
    NWMN_2170 (moaD)
    USA300_FPR3757:
    04-02981:
    SA2981_2208 (moaD)
    08BA02176:
    C248_2308 (moaD)
    11819-97:
    MS7_2289 (moaD)
    71193:
    ST398NM01_2321
    ECT-R 2:
    ECTR2_2131 (moaD)
    ED133:
    SAOV_2309c
    ED98:
    SAAV_2333 (moaD)
    HO 5096 0412:
    SAEMRSA15_21680 (moaD)
    JH1:
    SaurJH1_2337
    JH9:
    SaurJH9_2295
    JKD6008:
    SAA6008_02307 (moaD)
    JKD6159:
    SAA6159_02175 (moaD)
    LGA251:
    SARLGA251_20540 (moaD)
    M013:
    M013TW_2228
    MRSA252:
    SAR2354 (moaD)
    MSHR1132:
    SAMSHR1132_20950
    MSSA476:
    SAS2160
    Mu3:
    SAHV_2254 (moaD)
    Mu50:
    SAV2270 (moaD)
    MW2:
    MW2188 (moaD)
    RF122:
    SAB2142c (moaD)
    ST398:
    SAPIG2321 (moaD)
    T0131:
    SAT0131_02447
    TCH60:
    HMPREF0772_10928 (moaD)
    TW20:
    SATW20_24020 (moaD)
    USA300_TCH1516:
    USA300HOU_2252 (moaD)
    VC40:
    SAVC_10215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSD
    N315            MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSD
    NCTC8325        MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSD
    Newman          MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSD
    USA300_FPR3757  MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSD
                    ************************************************************

    COL             FIQPNDTVALIPPVSGG
    N315            FIQPNDTVALIPPVSGG
    NCTC8325        FIQPNDTVALIPPVSGG
    Newman          FIQPNDTVALIPPVSGG
    USA300_FPR3757  FIQPNDTVALIPPVSGG
                    *****************