From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2221 [new locus tag: SAUSA300_RS12270 ]
  • pan locus tag?: SAUPAN005731000
  • symbol: moaD
  • pan gene symbol?: moaD
  • synonym:
  • product: molybdopterin converting factor, subunit 1

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_2221 [new locus tag: SAUSA300_RS12270 ]
  • symbol: moaD
  • product: molybdopterin converting factor, subunit 1
  • replicon: chromosome
  • strand: -
  • coordinates: 2390906..2391139
  • length: 234
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAAGGTACTTTACTTCGCAGAAATTAAAGATATATTACAAAAAGCACAGGAAGATATT
    GTGCTTGAACAAGCATTGACTGTACAACAATTTGAAGATTTATTGTTTGAACGTTATCCG
    CAAATCAATAATAAAAAGTTTCAAGTTGCTGTAAATGAGGAATTTGTACAAAAATCGGAT
    TTCATTCAACCTAATGATACTGTTGCATTAATTCCACCGGTTAGTGGAGGTTAA
    60
    120
    180
    234

Protein[edit source | edit]

Protein Data Bank: 2Q5W
Protein Data Bank: 2QIE

General[edit source | edit]

  • locus tag: SAUSA300_2221 [new locus tag: SAUSA300_RS12270 ]
  • symbol: MoaD
  • description: molybdopterin converting factor, subunit 1
  • length: 77
  • theoretical pI: 4.19545
  • theoretical MW: 8871.09
  • GRAVY: -0.172727

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdopterin converting factor, subunit 1 (TIGR01682; HMM-score: 76.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinMoaD family protein (TIGR01687; HMM-score: 40.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiamine biosynthesis protein ThiS (TIGR01683; HMM-score: 16.2)
  • TheSEED:  
    Molybdenum cofactor biosynthesis Molybdopterin synthase sulfur carrier subunit 
  • PFAM:
    Ubiquitin (CL0072) ThiS; ThiS family (PF02597; HMM-score: 62.4)
    NADP_Rossmann (CL0063) UDPG_MGDP_dh_N; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain (PF03721; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.1
    • Ymax_pos: 26
    • Cmax: 0.109
    • Cmax_pos: 26
    • Smax: 0.119
    • Smax_pos: 18
    • Smean: 0.08
    • D: 0.092
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]