From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005732000
  • symbol?: moaE
  • description?: molybdopterin synthase catalytic subunit

      descriptions from strain specific annotations:

    • molybdopterin synthase catalytic subunit
    • molybdenum cofactor biosynthesis protein E
    • molybdopterin converting factor moa (subunit 2)
    • molybdopterin converting factor moa
    • molybdopterin synthase large subunit
    • molybdopterin converting factor, subunit 2
    • molybdopterin-converting factor subunit 2
    • molybdenum cofactor biosynthesis protein large subunit
    • Molybdenum cofactor biosynthesis protein MoaE
    • molybdopterin biosynthesis MoaE protein
    • Molybdopterin converting factor, large subunit
    • molybdopterin converting factor small subunit
    • Molybdopterin synthase catalytic subunit, MoaE
    • putative molybdopterin-synthase large subunit
  • strand?: -
  • coordinates?: 5832727..5833173
  • synteny block?: BlockID0044780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2264 (moaE)
    N315:
    SA2066 (moaE)
    NCTC8325:
    Newman:
    NWMN_2171 (moaE)
    USA300_FPR3757:
    04-02981:
    SA2981_2209 (moaE)
    08BA02176:
    C248_2309 (moaE)
    11819-97:
    MS7_2290 (moaE)
    71193:
    ST398NM01_2322
    ECT-R 2:
    ECTR2_2132
    ED133:
    SAOV_2310c
    ED98:
    SAAV_2334 (moaE)
    HO 5096 0412:
    SAEMRSA15_21690 (moaE)
    JH1:
    SaurJH1_2338
    JH9:
    SaurJH9_2296
    JKD6008:
    SAA6008_02308 (moaE)
    JKD6159:
    SAA6159_02176 (moaE)
    LGA251:
    SARLGA251_20550 (moaE)
    M013:
    M013TW_2229
    MRSA252:
    SAR2355 (moaE)
    MSHR1132:
    SAMSHR1132_20960
    MSSA476:
    SAS2161
    Mu3:
    SAHV_2255 (moaE)
    Mu50:
    SAV2271 (moaE)
    MW2:
    MW2189 (moaE)
    RF122:
    SAB2143c (moaE)
    ST398:
    SAPIG2322 (moaE)
    T0131:
    SAT0131_02449
    TCH60:
    HMPREF0772_10927 (moaE)
    TW20:
    SATW20_24030 (moaE)
    USA300_TCH1516:
    USA300HOU_2253 (moaE)
    VC40:
    SAVC_10220

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
    N315            MKQFEIVIEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
    NCTC8325        MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
    Newman          MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
    USA300_FPR3757  MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
                    ******* ****************************************************

    COL             AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
    N315            AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
    NCTC8325        AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
    Newman          AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
    USA300_FPR3757  AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
                    ************************************************************

    COL             IWKKEIWEDGSKWQGHQKGNYEEAKREE
    N315            IWKKEIWEDGSKWQGHQKGNYEEAKREE
    NCTC8325        IWKKEIWEDGSKWQGHQKGNYEEAKREE
    Newman          IWKKEIWEDGSKWQGHQKGNYEEAKREE
    USA300_FPR3757  IWKKEIWEDGSKWQGHQKGNYEEAKREE
                    ****************************