From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2066 [new locus tag: SA_RS11885 ]
  • pan locus tag?: SAUPAN005732000
  • symbol: moaE
  • pan gene symbol?: moaE
  • synonym:
  • product: molybdopterin converting factor moa (subunit 2)

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2066 [new locus tag: SA_RS11885 ]
  • symbol: moaE
  • product: molybdopterin converting factor moa (subunit 2)
  • replicon: chromosome
  • strand: -
  • coordinates: 2328539..2328985
  • length: 447
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAACAATTTGAAATCGTGATAGAACCGATACAAACAGAACAATATCGTGAATTCACT
    ATAAATGAATATCAAGGTGCAGTAGTTGTTTTTACCGGTCATGTTCGCGAATGGACTAAA
    GGCGTCAAAACGGAATATTTAGAATATGAAGCGTATATTCCAATGGCTGAAAAGAAATTG
    GCACAAATTGGAGATGAAATAAATGAAAAATGGCCTGGAACGATAACGAGTATTGTTCAT
    AGAATAGGGCCATTACAAATTTCAGATATCGCTGTATTAATTGCAGTTTCTTCACCGCAT
    CGTAAAGATGCCTATCGAGCAAATGAATATGCAATTGAGCGTATAAAAGAAATTGTTCCG
    ATTTGGAAAAAAGAAATTTGGGAAGATGGTTCAAAATGGCAAGGGCATCAAAAAGGGAAT
    TATGAAGAAGCGAAGAGGGAGGAATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit source | edit]

Protein Data Bank: 2Q5W
Protein Data Bank: 2QIE

General[edit source | edit]

  • locus tag: SA2066 [new locus tag: SA_RS11885 ]
  • symbol: MoaE
  • description: molybdopterin converting factor moa (subunit 2)
  • length: 148
  • theoretical pI: 5.35216
  • theoretical MW: 17350.6
  • GRAVY: -0.629054

Function[edit source | edit]

  • reaction:
    EC 2.8.1.12?  ExPASy
    Molybdopterin synthaseCyclic pyranopterin phosphate + 2 [molybdopterin-synthase sulfur-carrier protein]-Gly-NH-CH2-C(O)SH + H2O = molybdopterin + 2 [molybdopterin-synthase sulfur-carrier protein]
  • TIGRFAM:
  • TheSEED:  
    Molybdenum cofactor biosynthesis Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12) 
  • PFAM:
    no clan definedMoaE; MoaE protein (PF02391; HMM-score: 119.2)
    Thioredoxin (CL0172) AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 14.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.1
    • Ymax_pos: 70
    • Cmax: 0.121
    • Cmax_pos: 45
    • Smax: 0.113
    • Smax_pos: 17
    • Smean: 0.072
    • D: 0.089
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKQFEIVIEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLAQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIWEDGSKWQGHQKGNYEEAKREE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Juma N Daniels, Margot M Wuebbens, K V Rajagopalan, Hermann Schindelin
Crystal structure of a molybdopterin synthase-precursor Z complex: insight into its sulfur transfer mechanism and its role in molybdenum cofactor deficiency.
Biochemistry: 2008, 47(2);615-26
[PubMed:18092812] [WorldCat.org] [DOI] (P p)