From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2067 [new locus tag: SA_RS11890 ]
  • pan locus tag?: SAUPAN005733000
  • symbol: mobB
  • pan gene symbol?: mobB
  • synonym:
  • product: molybdopterin-guanine dinucleotide biosynthesis mobB

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2067 [new locus tag: SA_RS11890 ]
  • symbol: mobB
  • product: molybdopterin-guanine dinucleotide biosynthesis mobB
  • replicon: chromosome
  • strand: -
  • coordinates: 2328999..2329484
  • length: 486
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTTTACAAATTGTAGGTTACAAAAAGTCTGGTAAGACAACATTGATGAGGCATATT
    GTCTCTTTCTTAAAGACACATGGTTATACAGTTGCTACTATTAAACATCATGGGCATGCT
    AAGGAAGATATTCAATTACAGGATTCAGACGTCGATCACATGAAGCATTTTGAAGCGGGG
    GCAGATCAAAGTATTGTACAAGGTTTTCAATATCAGCAAACTGTAACACGTGTAGATAAT
    CAAAATCTTACTCAAATTATTGAGAAATCTGTTACAATTGACACCAATATCGTATTAGTT
    GAAGGCTTTAAAAATGCTGATTTTGAAAAAGTCGTAGTCTATCGAGATGAAGAAGAGTTG
    CAAGTATTACAACAATTGTCGAATGTTTGTTATAGCATTAATGTAAGGGAGCATGAAGAT
    TTTACAGCATTTGAGCAATGGTTATTAAATAAAATTAAAAATGATTGTGATACACAATTA
    ACATAG
    60
    120
    180
    240
    300
    360
    420
    480
    486

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2067 [new locus tag: SA_RS11890 ]
  • symbol: MobB
  • description: molybdopterin-guanine dinucleotide biosynthesis mobB
  • length: 161
  • theoretical pI: 5.80994
  • theoretical MW: 18597.9
  • GRAVY: -0.424845

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 131.7)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 17.4)
    DNA repair and recombination protein RadB (TIGR02237; HMM-score: 16.3)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 14.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 14)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.7)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.7)
    MetabolismAmino acid biosynthesisAromatic amino acid familychorismate mutase (TIGR01807; EC 5.4.99.5; HMM-score: 12.4)
    Cellular processesCellular processesSporulation and germinationstage V sporulation protein B (TIGR02900; HMM-score: 11.4)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsFolate and pterinesMolybdenum cofactor biosynthesis Molybdopterin-guanine dinucleotide biosynthesis protein MobB 
  • PFAM:
    P-loop_NTPase (CL0023) MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 97.8)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 21.2)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 18.5)
    AAA_30; AAA domain (PF13604; HMM-score: 17.7)
    AAA_14; AAA domain (PF13173; HMM-score: 14.8)
    ABC_tran; ABC transporter (PF00005; HMM-score: 14.5)
    AAA_18; AAA domain (PF13238; HMM-score: 14)
    DUF2478; Protein of unknown function (DUF2478) (PF10649; HMM-score: 12.7)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.7)
    AAA_22; AAA domain (PF13401; HMM-score: 12.4)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 13
    • Cmax: 0.133
    • Cmax_pos: 41
    • Smax: 0.492
    • Smax_pos: 7
    • Smean: 0.361
    • D: 0.257
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15927852 NCBI
  • RefSeq: NP_375385 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MILQIVGYKKSGKTTLMRHIVSFLKTHGYTVATIKHHGHAKEDIQLQDSDVDHMKHFEAGADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRDEEELQVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]