From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005733000
  • symbol?: mobB
  • description?: molybdopterin-guanine dinucleotide biosynthesis protein B

      descriptions from strain specific annotations:

    • molybdopterin-guanine dinucleotide biosynthesis protein B
    • molybdopterin-guanine dinucleotide biosynthesis mobB
    • molybdopterin-guanine dinucleotide biosynthesis protein MobB
    • putative molybdopterin-guanine dinucleotidebiosynthesis protein B
  • strand?: -
  • coordinates?: 5833187..5833672
  • synteny block?: BlockID0044790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2265 (mobB)
    N315:
    SA2067 (mobB)
    NCTC8325:
    Newman:
    NWMN_2172 (mobB)
    USA300_FPR3757:
    04-02981:
    SA2981_2210 (mobB)
    08BA02176:
    C248_2310 (mobB)
    11819-97:
    MS7_2291 (mobB)
    71193:
    ST398NM01_2323
    ECT-R 2:
    ECTR2_2133 (mobB)
    ED133:
    SAOV_2311c
    ED98:
    SAAV_2335 (mobB)
    HO 5096 0412:
    SAEMRSA15_21700 (mobB)
    JH1:
    SaurJH1_2339
    JH9:
    SaurJH9_2297
    JKD6008:
    SAA6008_02309 (mobB)
    JKD6159:
    SAA6159_02177 (mobB)
    LGA251:
    SARLGA251_20560 (mobB)
    M013:
    M013TW_2230
    MRSA252:
    SAR2356 (mobB)
    MSHR1132:
    SAMSHR1132_20970
    MSSA476:
    SAS2162
    Mu3:
    SAHV_2256 (mobB)
    Mu50:
    SAV2272 (mobB)
    MW2:
    MW2190 (mobB)
    RF122:
    SAB2144c (mobB)
    ST398:
    SAPIG2323 (mobB)
    T0131:
    SAT0131_02450 (coaD)
    TCH60:
    HMPREF0772_10926 (mobB)
    TW20:
    SATW20_24040 (mobB)
    USA300_TCH1516:
    USA300HOU_2254 (mobB)
    VC40:
    SAVC_10225

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAG
    N315            MILQIVGYKKSGKTTLMRHIVSFLKTHGYTVATIKHHGHAKEDIQLQDSDVDHMKHFEAG
    NCTC8325        MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAG
    Newman          MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAG
    USA300_FPR3757  MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAG
                    *************************:*************.********************

    COL             ADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEEL
    N315            ADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRDEEEL
    NCTC8325        ADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEEL
    Newman          ADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEEL
    USA300_FPR3757  ADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEEL
                    *******************************************************:****

    COL             QVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT
    N315            QVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT
    NCTC8325        QVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT
    Newman          QVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT
    USA300_FPR3757  QVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT
                    *****************************************