From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005736000
  • symbol?: moaB
  • description?: molybdopterin biosynthesis moaB

      descriptions from strain specific annotations:

    • molybdopterin biosynthesis moaB
    • molybdenum cofactor synthesis domain-containing protein
    • molybdopterin precursor biosynthesis
    • molybdenum cofactor biosynthesis protein B
    • molybdopterin precursor biosynthesis moaB
    • molybdopterin cofactor biosynthesis protein MoaB
    • putative molybdenum cofactor biosynthesis protein B
    • molybdenum cofactor biosynthesis protein MoaB
  • strand?: -
  • coordinates?: 5835490..5835996
  • synteny block?: BlockID0044820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2268 (moaB)
    N315:
    SA2070 (moaB)
    NCTC8325:
    Newman:
    NWMN_2175 (moaB)
    USA300_FPR3757:
    04-02981:
    SA2981_2213 (moaB)
    08BA02176:
    C248_2313 (moaB)
    11819-97:
    MS7_2294 (moaB)
    71193:
    ST398NM01_2326
    ECT-R 2:
    ECTR2_2136
    ED133:
    SAOV_2314c
    ED98:
    SAAV_2338 (moaB)
    HO 5096 0412:
    SAEMRSA15_21730 (moaB)
    JH1:
    SaurJH1_2342
    JH9:
    SaurJH9_2300
    JKD6008:
    SAA6008_02312 (moaB)
    JKD6159:
    SAA6159_02180 (moaB)
    LGA251:
    SARLGA251_20590 (moaB)
    M013:
    M013TW_2233
    MRSA252:
    SAR2359 (moaB)
    MSHR1132:
    SAMSHR1132_21000
    MSSA476:
    SAS2165
    Mu3:
    SAHV_2259 (moaB)
    Mu50:
    SAV2275 (moaB)
    MW2:
    MW2193 (moaB)
    RF122:
    SAB2147c (moaB)
    ST398:
    SAPIG2326
    T0131:
    SAT0131_02453
    TCH60:
    HMPREF0772_10923 (moaB)
    TW20:
    SATW20_24070 (moaB)
    USA300_TCH1516:
    USA300HOU_2257 (moaB)
    VC40:
    SAVC_10240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGEHQNVKLNRTVKAAVLTVSDTRDFDTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVA
    N315            MGEHQNVKLNRTVKAAVLTVSDTRDFVTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVA
    NCTC8325        MGEHQNVKLNRTVKAAVLTVSDTRDFDTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVA
    Newman          MGEHQNVKLNRTVKAAVLTVSDTRDFDTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVA
    USA300_FPR3757  MGEHQNVKLNRTVKAAVLTVSDTRDFDTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVA
                    ************************** *********************************

    COL             ITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYVEDVGT
    N315            ITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYVEDVGT
    NCTC8325        ITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYVEDVGT
    Newman          ITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYVEDVGT
    USA300_FPR3757  ITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIDGFGELFRYLSYVEDVGT
                    ******************************************:*****************

    COL             RALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK
    N315            RALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK
    NCTC8325        RALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK
    Newman          RALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK
    USA300_FPR3757  RALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK
                    ************************************************