From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005737000
  • symbol?: moeB
  • description?: molybdopterin biosynthesis protein moeB

      descriptions from strain specific annotations:

    • molybdopterin biosynthesis protein moeB
    • molybdopterin biosynthesis MoeB protein
    • molybdopterin biosynthesis MoeB
    • molybdopterin biosynthesis protein B
    • moeZ/MoeB domain protein
    • putative molybdopterin synthase sulfurylase
    • thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein
    • UBA/THIF-type NAD/FAD binding protein
  • strand?: -
  • coordinates?: 5836020..5836936
  • synteny block?: BlockID0044830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2071 (moeB)
    NCTC8325:
    Newman:
    NWMN_2176 (moeB)
    USA300_FPR3757:
    04-02981:
    SA2981_2214 (moeB)
    08BA02176:
    C248_2314 (moeB)
    11819-97:
    MS7_2295
    71193:
    ST398NM01_2327
    ECT-R 2:
    ECTR2_2137
    ED133:
    SAOV_2315c
    ED98:
    SAAV_2339
    HO 5096 0412:
    SAEMRSA15_21740 (moeB)
    JH1:
    SaurJH1_2343
    JH9:
    SaurJH9_2301
    JKD6008:
    SAA6008_02313
    JKD6159:
    SAA6159_02181
    LGA251:
    SARLGA251_20600 (moeB)
    M013:
    M013TW_2234
    MRSA252:
    SAR2360 (moeB)
    MSHR1132:
    SAMSHR1132_21010
    MSSA476:
    SAS2166
    Mu3:
    SAHV_2260 (moeB)
    Mu50:
    SAV2276 (moeB)
    MW2:
    MW2194 (moeB)
    RF122:
    SAB2148c (moeB)
    ST398:
    SAPIG2327
    T0131:
    SAT0131_02454 (rpmF)
    TCH60:
    HMPREF0772_10922 (moeB)
    TW20:
    SATW20_24080 (moeB)
    USA300_TCH1516:
    USA300HOU_2258 (moeB)
    VC40:
    SAVC_10245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQERYSRQILFKQIGEIGQSKINQKCALIIGMGALGTHVAEGLVRAGIAKLIIVDRDYI
    N315            MSQERYSRQILFKQIGEIGQSKINQKCALIIGMGALGTHVAEGLVRAGIAKLIIVDRDYI
    NCTC8325        MSQERYSRQILFKQIGEIGQSKINQKCALIIGMGALGTHVAEGLVRAGIAKLIIVDRDYI
    Newman          MSQERYSRQILFKQIGEIGQSKINQKCALIIGMGALGTHVAEGLVRAGIAKLIIVDRDYI
    USA300_FPR3757  MSQERYSRQILFKQIGEIGQSKINQKCALIIGMGALGTHVAEGLVRAGIAKLIIVDRDYI
                    ************************************************************

    COL             EFSNLQRQTLFTEEDALKMMPKVVAAKKHLLALRSDVDIDDYIAHVDYYFLETHGQDVDV
    N315            EFSNLQRQTLFTEEDALKMMPKVVAAKKHLLALRSDVDIDGCIAHVDYYFLETHGQDVDV
    NCTC8325        EFSNLQRQTLFTEEDALKMMPKVVAAKKHLLALRSDVDIDDYIAHVDYYFLETHGQDVDV
    Newman          EFSNLQRQTLFTEEDALKMMPKVVAAKKHLLALRSDVDIDDYIAHVDYYFLETHGQDVDV
    USA300_FPR3757  EFSNLQRQTLFTEEDALKMMPKVVAAKKHLLALRSDVDIDDYIAHVDYYFLETHGQDVDV
                    ****************************************. ******************

    COL             IIDATDNFETRQLINDFAYKYRIPWIYGGVVQSTYTEAAFIPGKTPCFNCLVPQLPALNL
    N315            IIDATDNFETRQLINDFAYKHRIPWIYGGVVQSTYTEAAFIPGKTPCFNCLVPQLPALNL
    NCTC8325        IIDATDNFETRQLINDFAYKYRIPWIYGGVVQSTYTEAAFIPGKTPCFNCLVPQLPALNL
    Newman          IIDATDNFETRQLINDFAYKYRIPWIYGGVVQSTYTEAAFIPGKTPCFNCLVPQLPALNL
    USA300_FPR3757  IIDATDNFETRQLINDFAYKYRIPWIYGGVVQSTYTEAAFIPGKTPCFNCLVPQLPALNL
                    ********************:***************************************

    COL             TCDTVGVIQPAVTMATSLQLRDAMKVLTEQPIDTKITYGDIWEGSHYSFGFSKMQRSDCT
    N315            TCDTVGVIQPAVTMATSLQLRDAMKVLTEQPIDTKITYGDIWEGSHYSFGFSKMQRSDCT
    NCTC8325        TCDTVGVIQPAVTMATSLQLRDAMKVLTEQPIDTKITYGDIWEGSHYSFGFSKMQRSDCT
    Newman          TCDTVGVIQPAVTMATSLQLRDAMKVLTEQPIDTKITYGDIWEGSHYSFGFSKMQRSDCT
    USA300_FPR3757  TCDTVGVIQPAVTMATSLQLRDAMKVLTEQPIDTKITYGDIWEGSHYSFGFSKMQRSDCT
                    ************************************************************

    COL             TCGDVPSYPYLNKNEQRYATLCGRDTVQYENASITHDILVQFLKQHQLNYRSNSYMVMFE
    N315            TCGDVPSYPYLNKNEQRYATLCGRDTVQYENASITHDILVQFLKQHQLNYRSNSYMVMFE
    NCTC8325        TCGDVPSYPYLNKNEQRYATLCGRDTVQYENASITHDILVQFLKQHQLNYRSNSYMVMFE
    Newman          TCGDVPSYPYLNKNEQRYATLCGRDTVQYENASITHDILVQFLKQHQLNYRSNSYMVMFE
    USA300_FPR3757  TCGDVPSYPYLNKNEQRYATLCGRDTVQYENASITHDILVQFLKQHQLNYRSNSYMVMFE
                    ************************************************************

    COL             FKGHRIVAFKGGRFLIHGMTRTSDATHLMNLLFG
    N315            FKGHRIVAFKGGRFLIHGMTRTSDATHLMNLLFG
    NCTC8325        FKGHRIVAFKGGRFLIHGMTRTSDATHLMNLLFG
    Newman          FKGHRIVAFKGGRFLIHGMTRTSDATHLMNLLFG
    USA300_FPR3757  FKGHRIVAFKGGRFLIHGMTRTSDATHLMNLLFG
                    **********************************