From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005739000
  • symbol?: modB
  • description?: molybdenum ABC transporter permease

      descriptions from strain specific annotations:

    • molybdenum ABC transporter permease
    • molybdenum ABC transporter permease ModB
    • molybdate ABC transporter inner membrane subunit
    • molybdate ABC transporter permease
    • Molybdenum transport system permease protein modB
    • molybdenum transport system permease
    • molybdenum ABC transporter membrane protein
    • putative molybdenum transport system permeaseprotein
    • molybdenum (Mo2+) ABC superfamily ATP binding cassette transporter, membrane protein
    • Molybdenum transport system permease ModB
    • molybdate ABC transporter, permease protein
    • ModB protein
    • molybdenum transport system permease protein
    • molybdate transport permease protein
    • molybdate ABC superfamily ATP binding cassette transporter, permease protein
  • strand?: -
  • coordinates?: 5837812..5838483
  • synteny block?: BlockID0044850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2271 (modB)
    N315:
    SA2073 (modB)
    NCTC8325:
    Newman:
    NWMN_2178 (modB)
    USA300_FPR3757:
    04-02981:
    SA2981_2216 (modB)
    08BA02176:
    C248_2316 (modB)
    11819-97:
    MS7_2297 (modB)
    71193:
    ST398NM01_2329
    ECT-R 2:
    ECTR2_2139 (modB)
    ED133:
    SAOV_2317c
    ED98:
    SAAV_2341 (modB)
    HO 5096 0412:
    SAEMRSA15_21760 (modB)
    JH1:
    SaurJH1_2345
    JH9:
    SaurJH9_2303
    JKD6008:
    SAA6008_02315 (modB)
    JKD6159:
    SAA6159_02183 (modB)
    LGA251:
    SARLGA251_20620 (modB)
    M013:
    M013TW_2236
    MRSA252:
    SAR2362 (modB)
    MSHR1132:
    SAMSHR1132_21030
    MSSA476:
    SAS2168
    Mu3:
    SAHV_2262 (modB)
    Mu50:
    SAV2278 (modB)
    MW2:
    MW2196 (modB)
    RF122:
    SAB2150c (modB)
    ST398:
    SAPIG2329 (modB)
    T0131:
    SAT0131_02456 (isdA)
    TCH60:
    HMPREF0772_10920 (modB)
    TW20:
    SATW20_24100 (modB)
    USA300_TCH1516:
    USA300HOU_2260 (modB)
    VC40:
    SAVC_10255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPDLTPFWISIRVAVISTIIVTVLGIFISKWLYRRKGSWVKVLESLLILPIVLPPTVLGF
    N315            MPDLTPFWISIRVAVISTIIVTVLGIFISKWLYRRKGSWVKVLESLLILPIVLPPTVLGF
    NCTC8325        MPDLTPFWISIRVAVISTIIVTVLGIFISKWLYRRKGSWVKVLESLLILPIVLPPTVLGF
    Newman          MPDLTPFWISIRVAVISTIIVTVLGIFISKWLYRRKGSWVKVLESLLILPIVLPPTVLGF
    USA300_FPR3757  MPDLTPFWISIRVAVISTIIVTVLGIFISKWLYRRKGSWVKLLESLLILPIVLPPTVLGF
                    *****************************************:******************

    COL             ILLIIFSPRGPIGQFFANVLHLPVVFTLTGAVIASVIVSFPLMYQHTVQGFRGIDTKMIN
    N315            ILLIIFSPRGPIGQFFANVLHLPVVFTLTGAVIASVIVSFPLMYQHTVQGFRGIDTKMIN
    NCTC8325        ILLIIFSPRGPIGQFFANVLHLPVVFTLTGAVIASVIVSFPLMYQHTVQGFRGIDTKMIN
    Newman          ILLIIFSPRGPIGQFFANVLHLPVVFTLTGAVIASVIVSFPLMYQHTVQGFRGIDTKMIN
    USA300_FPR3757  ILLIIFSPRGPIGQFFANVLHLPVVFTLTGAVIASVIVSFPLMYQHTVQGFRGIDTKMIN
                    ************************************************************

    COL             TARTMGASETKIFLKLILPLAKRSILAGIMMSFARALGEFGATLMVAGYIPNKTNTLPLE
    N315            TARTMGASETKIFLKLILPLAKRSILAGIMMSFARALGEFGATLMVAGYIPNKTNTLPLE
    NCTC8325        TARTMGASETKIFLKLILPLAKRSILAGIMMSFARALGEFGATLMVAGYIPNKTNTLPLE
    Newman          TARTMGASETKIFLKLILPLAKRSILAGIMMSFARALGEFGATLMVAGYIPNKTNTLPLE
    USA300_FPR3757  TARTMGASETKIFLKLILPLAKRSILAGIMMSFARALGEFGATLMVAGYIPNKTNTLPLE
                    ************************************************************

    COL             IYFLVEQGRENEAWLWVLVLVAFSIVVISTINLLNKDKYKEVD
    N315            IYFLVEQGRENEAWLWVLVLVAFSIVVISTINLLNKDKYKEVD
    NCTC8325        IYFLVEQGRENEAWLWVLVLVAFSIVVISTINLLNKDKYKEVD
    Newman          IYFLVEQGRENEAWLWVLVLVAFSIVVISTINLLNKDKYKEVD
    USA300_FPR3757  IYFLVEQGRENEAWLWVLVLVAFSIVVISTINLLNKDKYKEVD
                    *******************************************