From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005747000
  • symbol?: fhuD2
  • description?: ferrichrome ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • ferrichrome ABC transporter substrate-binding protein
    • iron compound ABC transporter iron compound-binding protein
    • Periplasmic binding protein
    • putative ferrichrome-binding lipoproteinprecursor
    • Aerobactin binding protein
    • ferrichrome-binding lipoprotein precursor
    • ferrichrome-binding periplasmic protein
    • Ferrichrome-binding periplasmic protein precursor
    • ferrichrome-binding protein
    • ferric hydroxamate receptor 1
    • iron (Fe+3) ABC superfamily ATP binding cassette transporter, binding protein
    • iron (Fe+3) ABC transporter binding protein
    • iron compound ABC transporter, iron compound-binding protein
    • periplasmic binding family protein
  • strand?: -
  • coordinates?: 5844538..5845446
  • synteny block?: BlockID0044930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2222 (fhuD2)
    08BA02176:
    C248_2323
    11819-97:
    MS7_2303
    71193:
    ST398NM01_2335
    ECT-R 2:
    ECTR2_2145
    ED133:
    SAOV_2323c
    ED98:
    SAAV_2347
    HO 5096 0412:
    SAEMRSA15_21820
    JH1:
    SaurJH1_2351
    JH9:
    SaurJH9_2309
    JKD6008:
    SAA6008_02321 (fhuD)
    JKD6159:
    SAA6159_02189 (fhuD)
    LGA251:
    SARLGA251_20680 (fhuD)
    M013:
    M013TW_2242
    MRSA252:
    SAR2368
    MSHR1132:
    SAMSHR1132_21100
    MSSA476:
    SAS2174
    Mu3:
    SAHV_2268
    Mu50:
    SAV2284
    MW2:
    MW2202
    RF122:
    SAB2156c (fhuD2)
    ST398:
    SAPIG2335
    T0131:
    SAT0131_02462 (srtB)
    TCH60:
    HMPREF0772_10913
    TW20:
    SATW20_24160 (fhuD)
    USA300_TCH1516:
    USA300HOU_2266
    VC40:
    SAVC_10285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLLLPLIIMLLVLAACGNQGEKNNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGG
    N315            MKKLLLPLIIMLLVLAACGNQGEKNNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGG
    NCTC8325        MKKLLLPLIIMLLVLAACGNQGEKNNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGG
    Newman          MKKLLLPLIIMLLVLAACGNQGEKNNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGG
    USA300_FPR3757  MKKLLLPLIIMLLVLAACGNQGEKNNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGG
                    ************************************************************

    COL             LKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQ
    N315            LKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQ
    NCTC8325        LKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQ
    Newman          LKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQ
    USA300_FPR3757  LKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQ
                    ************************************************************

    COL             KVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATV
    N315            KVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATV
    NCTC8325        KVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATV
    Newman          KVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATV
    USA300_FPR3757  KVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATV
                    ************************************************************

    COL             SLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDY
    N315            SLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDY
    NCTC8325        SLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDY
    Newman          SLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDY
    USA300_FPR3757  SLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDY
                    ************************************************************

    COL             IVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKA
    N315            IVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKA
    NCTC8325        IVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKA
    Newman          IVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKA
    USA300_FPR3757  IVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKA
                    ************************************************************

    COL             AK
    N315            AK
    NCTC8325        AK
    Newman          AK
    USA300_FPR3757  AK
                    **