From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2235 [new locus tag: SAUSA300_RS12340 ]
  • pan locus tag?: SAUPAN005747000
  • symbol: SAUSA300_2235
  • pan gene symbol?: fhuD2
  • synonym:
  • product: iron compound ABC transporter iron compound-binding protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_2235 [new locus tag: SAUSA300_RS12340 ]
  • symbol: SAUSA300_2235
  • product: iron compound ABC transporter iron compound-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2401805..2402713
  • length: 909
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAAAAAACTATTATTACCATTAATAATTATGTTATTAGTGTTAGCTGCGTGTGGGAAC
    CAAGGTGAAAAAAATAACAAAGCTGAAACTAAATCTTATAAAATGGACGATGGCAAAACG
    GTAGATATTCCGAAAGACCCTAAACGCATTGCAGTAGTTGCGCCAACATATGCTGGTGGA
    CTTAAAAAATTAGGTGCAAACATTGTAGCTGTAAATCAACAAGTCGATCAAAGCAAAGTA
    TTAAAAGATAAATTTAAAGGTGTTACAAAAATTGGTGATGGCGATGTAGAAAAAGTTGCT
    AAAGAAAAGCCAGATTTAATTATTGTATACTCTACTGACAAAGATATTAAAAAATATCAA
    AAAGTAGCACCAACAGTAGTTGTTGACTATAATAAGCATAAATATTTAGAACAACAAGAA
    ATGTTAGGGAAAATTGTTGGTAAAGAAGATAAAGTAAAAGCTTGGAAGAAAGATTGGGAA
    GAAACAACTGCTAAAGACGGTAAAGAAATTAAAAAAGCAATTGGACAAGATGCAACAGTG
    TCATTGTTTGATGAATTTGATAAAAAATTATACACTTACGGCGATAACTGGGGTCGTGGT
    GGAGAAGTATTATATCAAGCATTTGGTTTGAAAATGCAACCAGAACAACAAAAGTTAACT
    GCAAAAGCAGGTTGGGCTGAAGTGAAACAAGAAGAAATTGAAAAATATGCTGGTGATTAC
    ATTGTGAGTACAAGTGAAGGTAAACCTACACCAGGATACGAATCAACAAACATGTGGAAG
    AATTTGAAAGCTACTAAAGAAGGACATATTGTTAAAGTTGATGCTGGTACATACTGGTAC
    AACGATCCTTATACATTAGATTTCATGCGTAAAGATTTAAAAGAAAAATTAATTAAAGCT
    GCAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    909

Protein[edit source | edit]

Protein Data Bank: 4B8Y

General[edit source | edit]

  • locus tag: SAUSA300_2235 [new locus tag: SAUSA300_RS12340 ]
  • symbol: SAUSA300_2235
  • description: iron compound ABC transporter iron compound-binding protein
  • length: 302
  • theoretical pI: 9.70204
  • theoretical MW: 34011
  • GRAVY: -0.665894

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 30.5)
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 28.9)
  • TheSEED:  
    Ferrichrome-binding periplasmic protein precursor (TC 3.A.1.14.3) 
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 96.2)
    P-loop_NTPase (CL0023) PIF1; PIF1-like helicase (PF05970; HMM-score: 12.5)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 11)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 10.2)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: VLAACGN
  • SignalP: Signal peptide length 29 aa
    • Ymax: 0.385
    • Ymax_pos: 29
    • Cmax: 0.244
    • Cmax_pos: 29
    • Smax: 0.902
    • Smax_pos: 16
    • Smean: 0.743
    • D: 0.524
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLLLPLIIMLLVLAACGNQGEKNNKAETKSYKMDDGKTVDIPKDPKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIKKYQKVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKDGKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTLDFMRKDLKEKLIKAAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 1.125 1.126 1.127 1.128 1.129 1.130 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]