From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005778000
  • symbol?:
  • description?: Salicylate hydroxylase

      descriptions from strain specific annotations:

    • Salicylate hydroxylase
    • FAD binding domain protein
    • putative monooxygenase
    • FAD-dependent oxidoreductase
    • Monooxygenase family protein
    • flavin containing amine oxidoreductase family protein
  • strand?: -
  • coordinates?: 5866586..5867710
  • synteny block?: BlockID0045230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2244
    08BA02176:
    C248_2346
    11819-97:
    MS7_2323
    71193:
    ST398NM01_2356
    ECT-R 2:
    ECTR2_2165
    ED133:
    SAOV_2345c
    ED98:
    SAAV_2367
    HO 5096 0412:
    SAEMRSA15_22030
    JH1:
    SaurJH1_2372
    JH9:
    SaurJH9_2329
    JKD6008:
    SAA6008_02341
    JKD6159:
    SAA6159_02209
    LGA251:
    SARLGA251_20880
    M013:
    M013TW_2262
    MRSA252:
    SAR2390
    MSHR1132:
    SAMSHR1132_21300
    MSSA476:
    SAS2197
    Mu3:
    SAHV_2290
    Mu50:
    SAV2306
    MW2:
    MW2225
    RF122:
    SAB2181c
    ST398:
    SAPIG2356
    T0131:
    SAT0131_02484
    TCH60:
    HMPREF0772_10891
    TW20:
    SATW20_24360
    USA300_TCH1516:
    USA300HOU_2287
    VC40:
    SAVC_10385

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIAIIGAGIGGLTAAALLQEQGHTIKVFEKNESVKEIGAGIGIGDNVLKKLGNHDLAKG
    N315            MKIAIIGAGIGGLTAAALLQEQGHTIKVFEKNESVKEIGAGIGIGDNVLKKLGNHDLAKG
    NCTC8325        MKIAIIGAGIGGLTAAALLQEQGHTIKVFEKNESVKEIGAGIGIGDNVLKKLGNHDLAKG
    Newman          MKIAIIGAGIGGLTAAALLQEQGHTIKVFEKNESVKEIGAGIGIGDNVLKKLGNHDLAKG
    USA300_FPR3757  MKIAIIGAGIGGLTAAALLQEQGHTIKVFEKNESVKEIGAGIGIGDNVLKKLGNHDLAKG
                    ************************************************************

    COL             IKNAGQILSTMTVLDDKDRLLTTVKLKSNTLNVTLPRQTLIDIIKSYVKDDAIFTNHEVT
    N315            IKNAGQILSTMTVLDDKDRLLTTVKLKSNTLNVTLPRQTLIDIIKSYVKDDVIFTNHEVT
    NCTC8325        IKNAGQILSTMTVLDDKDRLLTTVKLKSNTLNVTLPRQTLIDIIKSYVKDDAIFTNHEVT
    Newman          IKNAGQILSTMTVLDDKDRLLTTVKLKSNTLNVTLPRQTLIDIIKSYVKDDAIFTNHEVT
    USA300_FPR3757  IKNAGQILSTMTVLDDKDRLLTTVKLKSNTLNVTLPRQTLIDIIKSYVKDDAIFTNHEVT
                    ***************************************************.********

    COL             HIDNETDKVTIHFAEQESEAFDLCIGADGIHSKVRQSVNADSKVLYQGYTCFRGLIDDID
    N315            HIDNETDKVTIHFAEQESEAFDLCIGADGIHSKVRQSVNADSKVLYQGYTCFRGLIDDID
    NCTC8325        HIDNETDKVTIHFAEQESEAFDLCIGADGIHSKVRQSVNADSKVLYQGYTCFRGLIDDID
    Newman          HIDNETDKVTIHFAEQESEAFDLCIGADGIHSKVRQSVNADSKVLYQGYTCFRGLIDDID
    USA300_FPR3757  HIDNETDKVTIHFAEQESEAFDLCIGADGIHSKVRQSVNADSKVLYQGYTCFRGLIDDID
                    ************************************************************

    COL             LKHPDCAKEYWGRKGRVGIVPLLNNQAYWFITINSKENNHKYSSFGKPHLQAYFNHYPNE
    N315            LKHPDCAKEYWGRKGRVGIVPLLNNQAYWFITINSKENNHKYSSFGKPHLQAYFNHYPNE
    NCTC8325        LKHPDCAKEYWGRKGRVGIVPLLNNQAYWFITINSKENNHKYSSFGKPHLQAYFNHYPNE
    Newman          LKHPDCAKEYWGRKGRVGIVPLLNNQAYWFITINSKENNHKYSSFGKPHLQAYFNHYPNE
    USA300_FPR3757  LKHPDCAKEYWGRKGRVGIVPLLNNQAYWFITINSKENNHKYSSFGKPHLQAYFNHYPNE
                    ************************************************************

    COL             VREILDKQSETGILLHNIYDLKPLKSFVYGRTILLGDAAHATTPNMGQGAGQAMEDAIVL
    N315            VREILDKQSETGILLHNIYDLKPLKSFVYGRTILLGDAAHATTPNMGQGAGQAMEDAIVL
    NCTC8325        VREILDKQSETGILLHNIYDLKPLKSFVYGRTILLGDAAHATTPNMGQGAGQAMEDAIVL
    Newman          VREILDKQSETGILLHNIYDLKPLKSFVYGRTILLGDAAHATTPNMGQGAGQAMEDAIVL
    USA300_FPR3757  VREILDKQSETGILLHNIYDLKPLKSFVYGRTILLGDAAHATTPNMGQGAGQAMEDAIVL
                    ************************************************************

    COL             VNCFNAYDFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQYRSRLFVAVRNRIMKMMPNAL
    N315            VNCFNAYDFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQYRSRLFVAVRNRIMKMMPNAL
    NCTC8325        VNCFNAYDFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQYRSRLFVAVRNRIMKMMPNAL
    Newman          VNCFNAYDFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQYRSRLFVAVRNRIMKMMPNAL
    USA300_FPR3757  VNCFNAYDFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQYRSRLFVAVRNRIMKMMPNAL
                    ************************************************************

    COL             AAGQTKFLYKSKEK
    N315            AAGQTKFLYKSKEK
    NCTC8325        AAGQTKFLYKSKEK
    Newman          AAGQTKFLYKSKEK
    USA300_FPR3757  AAGQTKFLYKSKEK
                    **************