From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005807000
  • symbol?:
  • description?: Na_ antiporter

      descriptions from strain specific annotations:

    • Na_ antiporter
    • Na+/H+ antiporter NhaC
    • Na+ antiporter NhaC
    • Na+/H+ antiporter family protein
    • Methionine transporter MetT
    • NhaC family Na(+)/H(+) antiporter
    • putative transport protein
    • NhaC family sodium:proton (Na+:H) antiporter
  • strand?: -
  • coordinates?: 5893977..5895189
  • synteny block?: BlockID0045520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2265 (metT)
    08BA02176:
    C248_2369
    11819-97:
    MS7_2343
    71193:
    ST398NM01_2377
    ECT-R 2:
    ECTR2_2185
    ED133:
    SAOV_2366c
    ED98:
    SAAV_2388
    HO 5096 0412:
    SAEMRSA15_22240
    JH1:
    SaurJH1_2394
    JH9:
    SaurJH9_2351
    JKD6008:
    SAA6008_02362
    JKD6159:
    SAA6159_02230
    LGA251:
    SARLGA251_21090
    M013:
    M013TW_2284
    MRSA252:
    SAR2411
    MSHR1132:
    SAMSHR1132_21510
    MSSA476:
    SAS2219
    Mu3:
    SAHV_2310
    Mu50:
    SAV2326
    MW2:
    MW2247
    RF122:
    SAB2203c
    ST398:
    SAPIG2377
    T0131:
    SAT0131_02509
    TCH60:
    HMPREF0772_10869
    TW20:
    SATW20_24580
    USA300_TCH1516:
    USA300HOU_2306
    VC40:
    SAVC_10495

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------------MEVHKKSNAWALFPLLLFVALFLGVGIITGDFTSMPLN
    N315            MKTSFFIVCEKEVFLIGKQVKRMEVHKKSNAWALFPLLLFVALFLGVGIITGDFTSMPLN
    NCTC8325        --------------------------------------------------------MPLN
    Newman          MKTSFFIVCEKEVFLIGKQVKRMEVHKKSNAWALFPLLLFVALFLGVGIITGDFTSMPLN
    USA300_FPR3757  MKTSFFIVCEKEVFLIGKQVKRMEVHKKSNAWALFPLLLFVALFLGVGIITGDFTSMPLN
                                                                            ****

    COL             VAITITVIVALLMNRKESFAKKVEVFTKGAGHSNIVLMMLIFILAGAFSNTAEKMGGVKS
    N315            VAITITVIVALLMNRKESFAKKVEVFTKGAGHSNIILMMLIFILAGAFSNTAEKMGGVKS
    NCTC8325        VAITITVIVALLMNRKESFAKKVEVFTKGAGHSNIVLMMLIFILAGAFSNTAEKMGGVKS
    Newman          VAITITVIVALLMNRKESFAKKVEVFTKGAGHSNIVLMMLIFILAGAFSNTAEKMGGVKS
    USA300_FPR3757  VAITITVIVALLMNRKESFAKKVEVFTKGAGHSNIVLMMLIFILAGAFSNTAEKMGGVKS
                    ***********************************:************************

    COL             TVNLGLSLIPENLIIVGLFVICMFVSISMGTSVGTVAAIAPVGYGFAQATDVPTALAMAT
    N315            TVNLGLSLIPENLIIVGLFVICMFVSISMGTSVGTVAAIAPVGYGFAQATDVPTALAMAT
    NCTC8325        TVNLGLSLIPENLIIVGLFVICMFVSISMGTSVGTVAAIAPVGYGFAQATDVPTALAMAT
    Newman          TVNLGLSLIPENLIIVGLFVICMFVSISMGTSVGTVAAIAPVGYGFAQATDVPTALAMAT
    USA300_FPR3757  TVNLGLSLIPENLIIVGLFVICMFVSISMGTSVGTVAAIAPVGYGFAQATDVPTALAMAT
                    ************************************************************

    COL             VVGGAMFGDNLSMISDTTIAAVRTQHTKMKDKFRVNFKIVLPGAILTIIILYFLTNGISL
    N315            VVGGAMFGDNLSMISDTTIAAVRTQHTKMKDKFRVNFKIVLPGAILTIIILYFLTNGISL
    NCTC8325        VVGGAMFGDNLSMISDTTIAAVRTQHTKMKDKFRVNFKIVLPGAILTIIILYFLTNGISL
    Newman          VVGGAMFGDNLSMISDTTIAAVRTQHTKMKDKFRVNFKIVLPGAILTIIILYFLTNGISL
    USA300_FPR3757  VVGGAMFGDNLSMISDTTIAAVRTQHTKMKDKFRVNFKIVLPGAILTIIILYFLTNGISL
                    ************************************************************

    COL             NHAKNYDYNLIKVVPYILVLVLALLGVNVIIVLIGGTLLAGIIGLIDGSFGWMGLLDAVS
    N315            NHAKNYDYNLIKVVPYILVLVLALLGVNVIIVLIGGTLLAGIIGLIDGSFGWMGLLDAVS
    NCTC8325        NHAKNYDYNLIKVVPYILVLVLALLGVNVIIVLIGGTLLAGIIGLIDGSFGWMGLLDAVS
    Newman          NHAKNYDYNLIKVVPYILVLVLALLGVNVIIVLIGGTLLAGIIGLIDGSFGWMGLLDAVS
    USA300_FPR3757  NHAKNYDYNLIKVVPYILVLVLALLGVNVIIVLIGGTLLAGIIGLIDGSFGWMGLLDAVS
                    ************************************************************

    COL             KGIISMEDIAMIALLIGGLVGIIQHNGGIEWLLQFVRSKVKSKRGAELGIASLVSVADIA
    N315            KGIISMEDIAMIALLIGGLVGIIQHNGGIEWLLQFVRSKVKSKRGAELGIASLVSVADIA
    NCTC8325        KGIISMEDIAMIALLIGGLVGIIQHNGGIEWLLQFVRSKVKSKRGAELGIASLVSVADIA
    Newman          KGIISMEDIAMIALLIGGLVGIIQHNGGIEWLLQFVRSKVKSKRGAELGIASLVSVADIA
    USA300_FPR3757  KGIISMEDIAMIALLIGGLVGIIQHNGGIEWLLQFVRSKVKSKRGAELGIASLVSVADIA
                    ************************************************************

    COL             TANNTISIIMSGPLAKNIADEYDVDSRKSASILDIFGGCFQGLLPYSPQVISAAGVAGIS
    N315            TANNTISIIMSGPLAKNIADEYDVDSRKSASILDIFGGCFQGLLPYSPQVISAAGVAGIS
    NCTC8325        TANNTISIIMSGPLAKNIADEYDVDSRKSASILDIFGGCFQGLLPYSPQVISAAGVAGIS
    Newman          TANNTISIIMSGPLAKNIADEYDVDSRKSASILDIFGGCFQGLLPYSPQVISAAGVAGIS
    USA300_FPR3757  TANNTISIIMSGPLAKNIADEYDVDSRKSASILDIFGGCFQGLLPYSPQVISAAGVAGIS
                    ************************************************************

    COL             PLMLFPYSIYPILLGVCGLIAILFNFPKLKKNTSQEMKH
    N315            PLMLFPYSIYPILLGVCGLIAILFNFPKLKKNTSQEMKH
    NCTC8325        PLMLFPYSIYPILLGVCGLIAILFNFPKLKKNTSQEMKH
    Newman          PLMLFPYSIYPILLGVCGLIAILFNFPKLKKNTSQEMKH
    USA300_FPR3757  PLMLFPYSIYPILLGVCGLIAILFNFPKLKKNTSQEMKH
                    ***************************************