From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005815000
  • symbol?:
  • description?: N-acetyl-L,L-diaminopimelate deacetylase

      descriptions from strain specific annotations:

    • N-acetyl-L,L-diaminopimelate deacetylase
    • M20/M25/M40 family peptidase
    • peptidase M20/M25/M40 family protein
    • amidohydrolase family protein
    • amidohydrolase subfamily
    • amino acid amidohydrolase
    • hippurate hydrolase
    • M20D subfamily peptidase
    • N-acetyl-L,L-diaminopimelate deacetylase-like protein
    • N-acyl-L-amino acid amidohydrolase
    • peptidase, aminoacylase
    • pseudogene
    • putative peptidase
  • strand?: -
  • coordinates?: 5897698..5898819
  • synteny block?: BlockID0045600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2268
    08BA02176:
    C248_2372
    11819-97:
    MS7_2347
    71193:
    ST398NM01_2381
    ECT-R 2:
    ECTR2_2189
    ED133:
    SAOV_2369c
    ED98:
    SAAV_2393
    HO 5096 0412:
    SAEMRSA15_22270
    JH1:
    SaurJH1_2397
    JH9:
    SaurJH9_2354
    JKD6008:
    SAA6008_02366
    JKD6159:
    SAA6159_02233
    LGA251:
    SARLGA251_21120
    M013:
    M013TW_2287
    MRSA252:
    SAR2414
    MSHR1132:
    SAMSHR1132_21540
    MSSA476:
    SAS2222
    Mu3:
    SAHV_2313
    Mu50:
    SAV2329
    MW2:
    MW2250
    RF122:
    SAB2206c
    ST398:
    SAPIG2381
    T0131:
    SAT0131_02513
    TCH60:
    HMPREF0772_10865 (hipO2)
    TW20:
    SATW20_24610
    USA300_TCH1516:
    USA300HOU_2309
    VC40:
    SAVC_10510

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGLKDQAVTWRRYFHQFPELSDKEFKTTQKIKDILTEHHIRILDLPLATGLVAEVGQGLS
    N315            MGLKDQAVTWRRYFHQFPELSDKEFKTTQKIKDILTEHHIRILDLPLMTGLVAEVGQGLS
    NCTC8325        MGLKDQAVTWRRYFHQFPELSDKEFKTTQKIKDILTEHHIRILDLPLATGLVAEVGQGLS
    Newman          MGLKDQAVTWRRYFHQFPELSDKEFKTTQKIKDILTEHHIRILDLPLATGLVAEVGQGLS
    USA300_FPR3757  MGLKDQAVTWRRYFHQFPELSDKEFKTTQKIKDILTEHHIRILDLPLATGLVAEVGQGLS
                    *********************************************** ************

    COL             CIAVRADIDALPIQELVEQDFKSENEGVMHACGHDIHMASILATAVKLKEIEGTLTGRVK
    N315            CIAVRADIDALPIQELVEQDFKSENEGVMHACGHDIHMASILATAVKLKEIEGTLTGRVK
    NCTC8325        CIAVRADIDALPIQELVEQDFKSENEGVMHACGHDIHMASILATAVKLKEIEGTLTGRVK
    Newman          CIAVRADIDALPIQELVEQDFKSENEGVMHACGHDIHMASILATAVKLKEIEGTLTGRVK
    USA300_FPR3757  CIAVRADIDALPIQELVEQDFKSENEGVMHACGHDIHMASILATAVKLKEIEGTLTGRVK
                    ************************************************************

    COL             FIFQSAEELGHGAFKIIETHALKDVQAVLGFHNDPSRSVGTFAIKTGAITSAVDRFEFHI
    N315            FIFQPAEELGHGAFKIIETDALKDVQAVLGFHNDPSRSVGTFAIKTGAITSAVDRFEFHI
    NCTC8325        FIFQSAEELGHGAFKIIETHALKDVQAVLGFHNDPSRSVGTFAIKTGAITSAVDRFEFHI
    Newman          FIFQSAEELGHGAFKIIETHALKDVQAVLGFHNDPSRSVGTFAIKTGAITSAVDRFEFHI
    USA300_FPR3757  FIFQSAEELGHGAFKIIETHALKDVQAVLGFHNDPSRSVGTFAIKTGAITSAVDRFEFHI
                    ****.**************.****************************************

    COL             KGVGGHAAKPEQCNDPVIVLAQLINSIQSIVSRNLSAFDEAVVTIGQISCGNTWNVIADH
    N315            KGVGGHAAKPEQCNDPVIVLAQLINSIQSIVSRNLSAFDEAVVTIGQISCGNTWNVIADH
    NCTC8325        KGVGGHAAKPEQCNDPVIVLAQLINSIQSIVSRNLSAFDEAVVTIGQISCGNTWNVIADH
    Newman          KGVGGHAAKPEQCNDPVIVLAQLINSIQSIVSRNLSAFDEAVVTIGQISCGNTWNVIADH
    USA300_FPR3757  KGVGGHAAKPEQCNDPVIVLAQLINSIQSIVSRNLSAFDEAVVTIGQISCGNTWNVIADH
                    ************************************************************

    COL             AYVQGTVRSFDPVVRKLVETRLQDIADGLAQAYNMKINLNYTHLPGAVMNDEALTHKAIA
    N315            AYVQGTVRSFDPVVRKLVETRLQDIADGLAQAYNMKINLNYTHLPGAVMNDEALTHKAIA
    NCTC8325        AYVQGTVRSFDPVVRKLVETRLQDIADGLAQAYNMKINLNYTHLPGAVMNDEALTHKAIA
    Newman          AYVQGTVRSFDPVVRKLVETRLQDIADGLAQAYNMKINLNYTHLPGAVMNDEALTHKAIA
    USA300_FPR3757  AYVQGTVRSFDPVVRKLVETRLQDIADGLAQAYNMKINLNYTHLPGAVMNDEALTHKAIA
                    ************************************************************

    COL             VAQHVGYKVEMMEQPLTIGEDFSGYSQHFPSVFALIGSHSEYDLHHPQYKPDERILEKVP
    N315            VAQHVGYKVEMMEQPLTIGEDFSGYSQHFPSVFALIGSHSEYDLHHPQYKPDERILEKVP
    NCTC8325        VAQHVGYKVGMMEQPLTIGEDFSGYSQHFPSVFALIGSHSEYDLHHPQYKPDERILEKVP
    Newman          VAQHVGYKVEMMEQPLTIGEDFSGYSQHFPSVFALIGSHSEYDLHHPQYKPDERILEKVP
    USA300_FPR3757  VAQHVGYKVEMMEQPLTIGEDFSGYSQHFPSVFALIGSHSEYDLHHPQYKPDERILEKVP
                    ********* **************************************************

    COL             EYFVEFVKRLLHE
    N315            EYFVEFVKRLLHE
    NCTC8325        EYFVEFVKRLLHE
    Newman          EYFVEFVKRLLHE
    USA300_FPR3757  EYFVEFVKRLLHE
                    *************