From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005819000
  • symbol?: hutR
  • description?: LysR family transcriptional regulator

      descriptions from strain specific annotations:

    • LysR family transcriptional regulator
    • LysR substrate-binding
    • LysR family regulatory protein
    • regulatory helix-turn-helix protein, lysR family protein
    • bacterial regulatory helix-turn-helix , lysR family protein
  • strand?: +
  • coordinates?: 5904112..5904996
  • synteny block?: BlockID0045640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2271
    08BA02176:
    C248_2375
    11819-97:
    MS7_2350
    71193:
    ST398NM01_2384
    ECT-R 2:
    ECTR2_2192
    ED133:
    SAOV_2372
    ED98:
    SAAV_2396
    HO 5096 0412:
    SAEMRSA15_22300
    JH1:
    SaurJH1_2400
    JH9:
    SaurJH9_2357
    JKD6008:
    SAA6008_02369
    JKD6159:
    SAA6159_02237
    LGA251:
    SARLGA251_21150
    M013:
    M013TW_2290
    MRSA252:
    SAR2418
    MSHR1132:
    SAMSHR1132_21570
    MSSA476:
    SAS2225
    Mu3:
    SAHV_2316
    Mu50:
    SAV2332
    MW2:
    MW2253
    RF122:
    SAB2209
    ST398:
    SAPIG2384
    T0131:
    SAT0131_02516
    TCH60:
    HMPREF0772_10862
    TW20:
    SATW20_24640
    USA300_TCH1516:
    USA300HOU_2312
    VC40:
    SAVC_10525

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIIQLEYFLAIVKYNSFTKAAQFLHISQPSLTATIKKMEADLGYDLFTRSTKDIKITEK
    N315            MKIIQLEYFLAIVKYNSFTKAAQFLHISQPSLTATIKKMEADLGYDLFTRSTKDIKITEK
    NCTC8325        MKIIQLEYFLAIVKYNSFTKAAQFLHISQPSLTATIKKMEADLGYDLFTRSTKDIKITEK
    Newman          MKIIQLEYFLAIVKYNSFTKAAQFLHISQPSLTATIKKMEADLGYDLFTRSTKDIKITEK
    USA300_FPR3757  MKIIQLEYFLAIVKYNSFTKAAQFLHISQPSLTATIKKMEADLGYDLFTRSTKDIKITEK
                    ************************************************************

    COL             GIQFYRYASELVQQYRSTMEKMYDLSVTSEPRIKIGTLESTNQWIANLIRKHHSDYPEQQ
    N315            GIQFYRYASELVQQYRSTMEKMYDLSVTSEPRIKIGTLESTNQWIANLIRKHHSDYPEQQ
    NCTC8325        GIQFYRYASELVQQYRSTMEKMYDLSVTSEPRIKIGTLESTNQWIANLIRKHHSDYPEQQ
    Newman          GIQFYRYASELVQQYRSTMEKMYDLSVTSEPRIKIGTLESTNQWIANLIRKHHSDYPEQQ
    USA300_FPR3757  GIQFYRYASELVQQYRSTMEKMYDLSVTSEPRIKIGTLESTNQWIANLIRKHHSDYPEQQ
                    ************************************************************

    COL             YRLYEIHDKHQSIEQLLNFNIHLAITNEKITHEDIRSIPLYEESYILLAPKETFKNQNWV
    N315            YRLYEIHDKHQSIEQLLNFNIHLAITNEKITHEDIRSIPLYEESYILLAPKETFKNQNWV
    NCTC8325        YRLYEIHDKHQSIEQLLNFNIHLAITNEKITHEDIRSIPLYEESYILLAPKETFKNQNWV
    Newman          YRLYEIHDKHQSIEQLLNFNIHLAITNGKITHEDIRSIPLYEESYILLAPKETFKNQNWV
    USA300_FPR3757  YRLYEIHDKHQSIEQLLNFNIHLAITNEKITHEDIRSIPLYEESYILLAPKETFKNQNWV
                    *************************** ********************************

    COL             DVENLPLILPNKNSQVRKHLDDYFNRRNIRPNVVVETDRFESAVGFVHLGLGYAIIPRFY
    N315            DVENLPLILPNKNSQVRKHLDDYFNRRNIRPNVVVETDRFESAVGFVHLGLGYAIIPRFY
    NCTC8325        DVENLPLILPNKNSQVRKHLDDYFNRRNIRPNVVVETDRFESAVGFVHLGLGYAIIPRFY
    Newman          DVENLPLILPNKNSQVRKHLDDYFNRRNIRPNVVVETDRFESAVGFVHLGLGYAIIPRFY
    USA300_FPR3757  DVENLPLILPNKNSQVRKHLDDYFNRRNIRPNVVVETDRFESAVGFVHLGLGYAIIPRFY
                    ************************************************************

    COL             YQSFHTSNLEYKKIRPNLGRKIYINYHKKRKHSEQVHTFVQQCQDYLYGLLEAL
    N315            YQSFHTSNLEYKKIRPNLGRKIYINYHKKRKHSEQVHTFVQQCQDYLYGLLEAL
    NCTC8325        YQSFHTSNLEYKKIRPNLGRKIYINYHKKRKHSEQVHTFVQQCQDYLYGLLEAL
    Newman          YQSFHTSNLEYKKIRPNLGRKIYINYHKKRKHSEQVHTFVQQCQDYLYGLLEAL
    USA300_FPR3757  YQSFHTSNLEYKKIRPNLGRKIYINYHKKRKHSEQVHTFVQQCQDYLYGLLEAL
                    ******************************************************