From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005848000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 5924892..5925305
  • synteny block?: BlockID0045930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2288
    08BA02176:
    C248_2392
    11819-97:
    MS7_2367
    71193:
    ST398NM01_2401
    ECT-R 2:
    ECTR2_2209
    ED133:
    SAOV_2392
    ED98:
    SAAV_2413
    HO 5096 0412:
    SAEMRSA15_22470
    JH1:
    SaurJH1_2419
    JH9:
    SaurJH9_2373
    JKD6008:
    SAA6008_02386
    JKD6159:
    SAA6159_02253
    LGA251:
    SARLGA251_21310
    M013:
    M013TW_2306
    MRSA252:
    SAR2434
    MSHR1132:
    SAMSHR1132_21730
    MSSA476:
    SAS2240
    Mu3:
    SAHV_2333
    Mu50:
    SAV2349
    MW2:
    MW2270
    RF122:
    SAB2228
    ST398:
    SAPIG2401
    T0131:
    SAT0131_02535
    TCH60:
    HMPREF0772_10845
    TW20:
    SATW20_24800
    USA300_TCH1516:
    USA300HOU_2330
    VC40:
    SAVC_10605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
    N315            MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
    NCTC8325        MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
    Newman          MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
    USA300_FPR3757  MTDALQQKIHIELLDLLDDVKFELTELNAQKGLYINGPANQLLKRGVHMAYVQGQKQAID
                    ************************************************************

    COL             NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
    N315            NIMTIVEQQLEDQHFLEDYDKFQNEVTHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
    NCTC8325        NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
    Newman          NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
    USA300_FPR3757  NIMTIVEQQLEDQHFLEHYDKFQNEVAHRNYDKTANFAELSDIPRQFDNFLDQFYQIKGQ
                    *****************.********:*********************************

    COL             YFIITHINTLIGDFHSEAH
    N315            YFIITHINTLIGDFHSEAH
    NCTC8325        YFIITHINTLIGDFHSEAH
    Newman          YFIITHINTLIGDFHSEAH
    USA300_FPR3757  YFIITHINTLIGDFHSEAH
                    *******************