From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005858000
  • symbol?: tcaB
  • description?: TcaB protein

      descriptions from strain specific annotations:

    • TcaB protein
    • Bcr/CflA subfamily drug resistance transporter
    • Teicoplanin resistance associated membrane protein TcaB
    • drug resistance transporter, Bcr/CflA subfamily protein
    • teicoplanin resistance associated membrane protein TcaB protein
    • teicoplanin resistance associated protein B
    • major facilitator superfamily teicoplanin:cation symporter
    • teicoplanin resistance associated membraneprotein
    • MFS family major facilitator transporter, teicoplanin:cation symporter
    • Drug resistance transporter, Bcr/CflA subfamily
    • teicoplanin resistance protein TcaB
    • bicyclomycin and teicoplanin resistance protein
  • strand?: -
  • coordinates?: 5934663..5935880
  • synteny block?: BlockID0046030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2350 (tcaB)
    N315:
    SA2145 (tcaB)
    NCTC8325:
    Newman:
    NWMN_2256 (tcaB)
    USA300_FPR3757:
    04-02981:
    SA2981_2294 (tcaB)
    08BA02176:
    C248_2400 (tcaB)
    11819-97:
    MS7_2373
    71193:
    ST398NM01_2408
    ECT-R 2:
    ECTR2_2215
    ED133:
    SAOV_2398c
    ED98:
    SAAV_2419 (tcaB)
    HO 5096 0412:
    SAEMRSA15_22530 (tcaB)
    JH1:
    SaurJH1_2425
    JH9:
    SaurJH9_2379
    JKD6008:
    SAA6008_02392 (tcaB)
    JKD6159:
    SAA6159_02259 (tcaB)
    LGA251:
    SARLGA251_21370 (tcaB)
    M013:
    M013TW_2313
    MRSA252:
    SAR2441 (tcaB)
    MSHR1132:
    SAMSHR1132_21800
    MSSA476:
    SAS2246
    Mu3:
    SAHV_2339 (tcaB)
    Mu50:
    SAV2355 (tcaB)
    MW2:
    MW2276 (tcaB)
    RF122:
    SAB2234c (tcaB)
    ST398:
    SAPIG2408
    T0131:
    SAT0131_02542
    TCH60:
    HMPREF0772_10838 (tcaB)
    TW20:
    SATW20_24860 (tcaB)
    USA300_TCH1516:
    USA300HOU_2337 (tcaB)
    VC40:
    SAVC_10635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
    N315            MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
    NCTC8325        MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
    Newman          MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
    USA300_FPR3757  MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
                    ************************************************************

    COL             LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
    N315            LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
    NCTC8325        LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
    Newman          LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
    USA300_FPR3757  LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
                    ************************************************************

    COL             ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
    N315            ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
    NCTC8325        ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
    Newman          ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
    USA300_FPR3757  ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
                    ************************************************************

    COL             VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
    N315            VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
    NCTC8325        VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
    Newman          VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
    USA300_FPR3757  VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
                    ************************************************************

    COL             PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
    N315            PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
    NCTC8325        PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
    Newman          PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
    USA300_FPR3757  PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
                    ************************************************************

    COL             TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
    N315            TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
    NCTC8325        TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
    Newman          TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
    USA300_FPR3757  TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
                    ************************************************************

    COL             ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
    N315            ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
    NCTC8325        ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
    Newman          ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
    USA300_FPR3757  ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
                    ******************************************