From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005869000
  • symbol?: htrB
  • description?: hemin ABC transporter permease

      descriptions from strain specific annotations:

    • hemin ABC transporter permease
    • ABC transporter permease
    • permease domain-containing protein
    • Putative hemin transport system permease protein hrtB
    • ftsX-like permease family protein
    • Heme efflux system permease HrtB
    • hemin ABC superfamily ATP binding cassette transporter, membrane protein
    • hemin ABC superfamily ATP binding cassette transporter, permease component
    • hemin ABC transporter membrane protein
    • permease family protein
    • putative permease
  • strand?: -
  • coordinates?: 5941209..5942264
  • synteny block?: BlockID0046140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2299 (hrtB)
    08BA02176:
    C248_2405
    11819-97:
    MS7_2378
    71193:
    ST398NM01_2413
    ECT-R 2:
    ECTR2_2220
    ED133:
    SAOV_2404c
    ED98:
    SAAV_2425
    HO 5096 0412:
    SAEMRSA15_22580
    JH1:
    SaurJH1_2430
    JH9:
    SaurJH9_2384
    JKD6008:
    SAA6008_02398
    JKD6159:
    SAA6159_02264
    LGA251:
    SARLGA251_21430
    M013:
    M013TW_2318
    MRSA252:
    SAR2446
    MSHR1132:
    SAMSHR1132_21850
    MSSA476:
    SAS2251
    Mu3:
    SAHV_2344
    Mu50:
    SAV2360
    MW2:
    MW2281
    RF122:
    SAB2239c
    ST398:
    SAPIG2413
    T0131:
    SAT0131_02548
    TCH60:
    HMPREF0772_10832
    TW20:
    SATW20_24920
    USA300_TCH1516:
    USA300HOU_2343 (htrA)
    VC40:
    SAVC_10670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM
    N315            MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM
    NCTC8325        MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM
    Newman          MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM
    USA300_FPR3757  MKLAIKEIMFYKFRYILITLIILLLSIMVLFISGLAQGLGRENISLFEHFDNDEYVVQKM
                    ************************************************************

    COL             KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNIQTLKLSNKEQDVITMNDVKQQRIQLKKGD
    N315            KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNIQTLKLSNKEQDVITMNDVKQQRIQLKKGD
    NCTC8325        KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNIQTLKLSNKEQDVITMNDVKQQRIQLKKGD
    Newman          KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNIQTLKLSNKEQDVITMNDVKQQRIQLKKGD
    USA300_FPR3757  KEPQIEKSQLSDTQQNQIKKVIHQEPYKMNIQTLKLSNKEQDVITMNDVKQQRIQLKKGD
                    ************************************************************

    COL             YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA
    N315            YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA
    NCTC8325        YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA
    Newman          YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA
    USA300_FPR3757  YPKNAHEVAINDKLAADNIRVGDRLHFKNNSTSYRVSGILNDTMYAHSSIVLLNDNGFNA
                    ************************************************************

    COL             LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI
    N315            LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI
    NCTC8325        LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI
    Newman          LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI
    USA300_FPR3757  LNKVNTAFYPVKNLTQQQRDELNKINDVQVVSEKDLTGNIASYQAEQAPLNMMIVSLFAI
                    ************************************************************

    COL             TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS
    N315            TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS
    NCTC8325        TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS
    Newman          TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS
    USA300_FPR3757  TAIVLSAFFYVMTIQKISQIGILKAIGIKTRHLLSALVLQILTLTIIGVGIAVIIIVGLS
                    ************************************************************

    COL             FMMPVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE
    N315            FMMPVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE
    NCTC8325        FMMPVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE
    Newman          FMMPVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE
    USA300_FPR3757  FMMPVTMPFYLTTQNILLMVGIFILVAILGASLSFIKLFKVDPIEAIGGAE
                    ***************************************************