From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005873000
  • symbol?:
  • description?: DUF3021 domain-containing protein

      descriptions from strain specific annotations:

    • DUF3021 domain-containing protein
    • membrane associated protein
    • membrane protein
    • probable membrane protein
  • strand?: +
  • coordinates?: 5945043..5945498
  • synteny block?: BlockID0046180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2303
    08BA02176:
    C248_2409
    11819-97:
    MS7_2382
    71193:
    ST398NM01_2417
    ECT-R 2:
    ECTR2_2224
    ED133:
    SAOV_2408
    ED98:
    SAAV_2429
    HO 5096 0412:
    SAEMRSA15_22620
    JH1:
    SaurJH1_2434
    JH9:
    SaurJH9_2388
    JKD6008:
    SAA6008_02402
    JKD6159:
    SAA6159_02268
    LGA251:
    SARLGA251_21470
    M013:
    M013TW_2322
    MRSA252:
    SAR2450
    MSHR1132:
    SAMSHR1132_21890
    MSSA476:
    SAS2255
    Mu3:
    SAHV_2348
    Mu50:
    SAV2364
    MW2:
    MW2285
    RF122:
    SAB2243
    ST398:
    SAPIG2417
    T0131:
    SAT0131_02552 (tnpA-3)
    TCH60:
    HMPREF0772_10828
    TW20:
    SATW20_24960
    USA300_TCH1516:
    USA300HOU_2347
    VC40:
    SAVC_10690

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYTHFTETTVMLISIIL
    N315            MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYNHFTETTVMLISIIL
    NCTC8325        MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYTHFTETTVMLISIIL
    Newman          MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYTHFTETTVMLISIIL
    USA300_FPR3757  MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYTHFTETTVMLISIIL
                    *********************************************.**************

    COL             WLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTII
    N315            WLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTII
    NCTC8325        WLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTII
    Newman          WLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTII
    USA300_FPR3757  WLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTII
                    ************************************************************

    COL             FIVVYVLIWIIQFFKNKNYVDTINKQLKQLK
    N315            FIVIYVLIWIIQFFKNKNYVDTINEQLKQLK
    NCTC8325        FIVVYVLIWIIQFFKNKNYVDTINKQLKQLK
    Newman          FIVVYVLIWIIQFFKNKNYVDTINKQLKQLK
    USA300_FPR3757  FIVVYVLIWIIQFFKNKNYVDTINKQLKQLK
                    ***:********************:******