From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005878000
  • symbol?: lctP2
  • description?: L-lactate permease

      descriptions from strain specific annotations:

    • L-lactate permease
    • L-lactate permease 2
    • LctP family L-lactate permease
    • L-lactate permease lctP-like protein
    • L-lactate transport
    • putative L-lactate permease 2
    • transporter, lactate permease family protein
  • strand?: -
  • coordinates?: 5951383..5952981
  • synteny block?: BlockID0046230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2305 (lctP)
    08BA02176:
    C248_2411 (lldP2)
    11819-97:
    MS7_2384
    71193:
    ST398NM01_2419
    ECT-R 2:
    ECTR2_2226
    ED133:
    SAOV_2413c
    ED98:
    SAAV_2431
    HO 5096 0412:
    SAEMRSA15_22670 (lldP2)
    JH1:
    SaurJH1_2436
    JH9:
    SaurJH9_2390
    JKD6008:
    SAA6008_02404
    JKD6159:
    SAA6159_02270
    LGA251:
    SARLGA251_21520 (lldP2)
    M013:
    M013TW_2327
    MRSA252:
    SAR2455 (lldP2)
    MSHR1132:
    SAMSHR1132_21940
    MSSA476:
    SAS2257
    Mu3:
    SAHV_2350
    Mu50:
    SAV2366
    MW2:
    MW2287
    RF122:
    SAB2245c (lldP)
    ST398:
    SAPIG2419
    T0131:
    SAT0131_02556 (mraY)
    TCH60:
    HMPREF0772_10823 (lctP2)
    TW20:
    SATW20_24980 (lldP2)
    USA300_TCH1516:
    USA300HOU_2349
    VC40:
    SAVC_10700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLVNTFNPFDNLLLSSLIAAIPIVLFLLCLTVFKMKGIYAAITTLVVTLLIAIPFFKLPV
    N315            MLVNTFNPFDNLLLSSLIAAIPIVLFLLCLTVFKMKGIYAAITTLVVTLLIAIPFFKLPV
    NCTC8325        MLVNTFNPFDNLLLSSLIAAIPIVLFLLCLTVFKMKGIYAAITTLVVTLLIAIPFFKLPV
    Newman          MLVNTFNPFDNLLLSSLIAAIPIVLFLLCLTVFKMKGIYAAITTLVVTLLIAIPFFKLPV
    USA300_FPR3757  MLVNTFNPFDNLLLSSLIAAIPIVLFLLCLTVFKMKGIYAAITTLVVTLLIAIPFFKLPV
                    ************************************************************

    COL             GIASGAVVEGFFQGIIPIGYIVMMAVLLYKITVESGQFLTIQDSITNISQDQRIQVLLIG
    N315            GIASGAVVEGFFQGIIPIGYIVMMAVLLYKITVESGQFLTIQDSITNISQDQRIQVLLIG
    NCTC8325        GIASGAVVEGFFQGIIPIGYIVMMAVLLYKITVESGQFLTIQDSITNISQDQRIQVLLIG
    Newman          GIASGAVVEGFFQGIIPIGYIVMMAVLLYKITVESGQFLTIQDSITNISQDQRIQVLLIG
    USA300_FPR3757  GIASGAVVEGFFQGIIPIGYIVMMAVLLYKITVESGQFLTIQDSITNISQDQRIQVLLIG
                    ************************************************************

    COL             FAFNAFLEGAAGFGVPIAICALLLTQLGFNPLKAAMLCLVANAASGAFGAIGIPVGVVET
    N315            FAFNAFLEGAAGFGVPIAICALLLTQLGFNPLKAAMLCLVANAASGAFGAIGIPVGVVET
    NCTC8325        FAFNAFLEGAAGFGVPIAICALLLTQLGFNPLKAAMLCLVANAASGAFGAIGIPVGVVET
    Newman          FAFNAFLEGAAGFGVPIAICALLLTQLGFNPLKAAMLCLVANAASGAFGAIGIPVGVVET
    USA300_FPR3757  FAFNAFLEGAAGFGVPIAICALLLTQLGFNPLKAAMLCLVANAASGAFGAIGIPVGVVET
                    ************************************************************

    COL             LKLPGDVSVLGVSQSATLTLAIINFIIPFLLIFIIDGFRGVKETLPAILVVSITYTLTQG
    N315            LKLPGDVSVLGVSQSATLTLAIINFIIPFLLIFIIDGFRGVKETLPAILVVSITYTLTQG
    NCTC8325        LKLPGDVSVLGVSQSATLTLAIINFIIPFLLIFIIDGFRGVKETLPAILVVSITYTLTQG
    Newman          LKLPGDVSVLGVSQSATLTLAIINFIIPFLLIFIIDGFRGVKETLPAILVVSITYTLTQG
    USA300_FPR3757  LKLPGDVSVLGVSQSATLTLAIINFIIPFLLIFIIDGFRGVKETLPAILVVSITYTFTQG
                    ********************************************************:***

    COL             LLTVFSGPELADIIPPLLTMLALAVFSKKFQPKHIYRVNKDEEIEPAKAHSAKAVLHAWS
    N315            LLTVFSGPELADIIPPLLTMLALAVFSKKFQPKHIYRVNKDEEIEPAKAHSAKAVLHAWS
    NCTC8325        LLTVFSGPELADIIPPLLTMLALAVFSKKFQPKHIYRVNKDEEIEPAKAHSAKAVLHAWS
    Newman          LLTVFSGPELADIIPPLLTMLALAVFSKKFQPKHIYRVNKDEEIEPAKAHSAKAVLHAWS
    USA300_FPR3757  LLTVFSGPELADIIPPLLTMLALAVFSKKFQPKHIYRVNKDEEIEPAKAHSAKAVLHAWS
                    ************************************************************

    COL             PFIVLTVIVMIWSAPFFKNLFLPNGALSSLVFKFNLPGTISEVTHKPLVLTLNIIGQTGT
    N315            PFIVLTVIVMIWSAPFFKNLFLPNGALSSLVFKFNLPGTISEVTHKPLVLTLNIIGQTGT
    NCTC8325        PFIVLTVIVMIWSAPFFKNLFLPNGALSSLVFKFNLPGTISEVTHKPLVLTLNIIGQTGT
    Newman          PFIVLTVIVMIWSAPFFKNLFLPNGALSSLVFKFNLPGTISEVTHKPLVLTLNIIGQTGT
    USA300_FPR3757  PFIVLTVIVMIWSAPFFKNLFLPNGALSSLVFKFNLPGTISEVTHKPLVLTLNIIGQTGT
                    ************************************************************

    COL             AILLTIIITILMSKKVNFKDAGRLFGVTFKELWLPVLTICFILAISKITTYGGLSAAMGQ
    N315            AILLTIIITILMSKKVNFKDAVRLFGVTFKELWLPVLTICFILAISKITTYGGLSAAMGQ
    NCTC8325        AILLTIIITILMSKKVNFKDAGRLFGVTFKELWLPVLTICFILAISKITTYGGLSAAMGQ
    Newman          AILLTIIITILMSKKVNFKDAGRLFGVTFKELWLPVLTICFILAISKITTYGGLSAAMGQ
    USA300_FPR3757  AILLTIIITILMSKKVNFKDAGRLFGVTFKELWLPVLTICFILAISKITTYGGLSAAMGQ
                    ********************* **************************************

    COL             GIAKAGNVFPVLSPILGWIGVFMTGSVVNNNSLFAPIQASVAQQIGTSGSLLVSANTVGG
    N315            GIAKAGNVFPVLSPILGWIGVFMTGSVVNNNSLFAPIQASVAQQIGTSGSLLVSANTVGG
    NCTC8325        GIAKAGNVFPVLSPILGWIGVFMTGSVVNNNSLFAPIQASVAQQIGTSGSLLVSANTVGG
    Newman          GIAKAGNVFPVLSPILGWIGVFMTGSVVNNNSLFAPIQASVAQQIGTSGSLLVSANTVGG
    USA300_FPR3757  GIAKAGNVFPVLSPILGWIGVFMTGSVVNNNSLFAPIQASVAQQIGTSGSLLVSANTVGG
                    ************************************************************

    COL             VAAKLISPQSIAIATAAVKQVGKESELLKMTLKYSVCLLIFICIWTFILSLL
    N315            VAAKLISPQSIAIATAAVKQVGKESELLKMTLKYSVCLLIFICIWTFILSLL
    NCTC8325        VAAKLISPQSIAIATAAVKQVGKESELLKMTLKYSVCLLIFICIWTFILSLL
    Newman          VAAKLISPQSIAIATAAVKQVGKESELLKMTLKYSVCLLIFICIWTFILSLL
    USA300_FPR3757  VAAKLISPQSIAIATAAVKQVGKESELLKMTLKYSVCLLIFICIWTFILSLL
                    ****************************************************