From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005890000
  • symbol?: iruO
  • description?: thioredoxin reductase

      descriptions from strain specific annotations:

    • thioredoxin reductase
    • pyridine nucleotide-disulfide oxidoreductase
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • thioredoxin-disulfide reductase
    • ferredoxin--NADP reductase
    • pyridine nucleotide-disulphide oxidoreductase family protein
    • Pyridine oxidoreductase
  • strand?: -
  • coordinates?: 5962026..5963021
  • synteny block?: BlockID0046350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2311
    08BA02176:
    C248_2419
    11819-97:
    MS7_2390
    71193:
    ST398NM01_2426
    ECT-R 2:
    ECTR2_2232
    ED133:
    SAOV_2419c
    ED98:
    SAAV_2437
    HO 5096 0412:
    SAEMRSA15_22730
    JH1:
    SaurJH1_2442
    JH9:
    SaurJH9_2396
    JKD6008:
    SAA6008_02410
    JKD6159:
    SAA6159_02276
    LGA251:
    SARLGA251_21580
    M013:
    M013TW_2333
    MRSA252:
    SAR2461
    MSHR1132:
    SAMSHR1132_22010
    MSSA476:
    SAS2264
    Mu3:
    SAHV_2356
    Mu50:
    SAV2372
    MW2:
    MW2294
    RF122:
    SAB2252c
    ST398:
    SAPIG2426
    T0131:
    SAT0131_02562 (ftsZ)
    TCH60:
    HMPREF0772_10816 (trxB)
    TW20:
    SATW20_25040
    USA300_TCH1516:
    USA300HOU_2355 (trxB2)
    VC40:
    SAVC_10730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWDIGGIAPKPCH
    N315            -------------MYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWDIGGIAPKPCH
    NCTC8325        MKDVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWDIGGIAPKPCH
    Newman          MKDVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWDIGGIAPKPCH
    USA300_FPR3757  MKDVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWDIGGIAPKPCH
                                 :**********************************************

    COL             EILKDTIKQGLYFKPEVHLNERVVDIRKKAERHFEVETEAGEIYTSKAVIIAIGAGIINP
    N315            EILKDTIKQGLYFKPEVHLNERVVDIRKKAERHFEVETEAGEIYTSKAVIIAIGAGIINP
    NCTC8325        EILKDTIKQGLYFKPEVHLNERVVDIRKKAERHFEVETEAGEIYTSKAVIIAIGAGIINP
    Newman          EILKDTIKQGLYFKPEVHLNERVVDIRKKAERHFEVETEAGEIYTSKAVIIAIGAGIINP
    USA300_FPR3757  EILKDTIKQGLYFKPEVHLNERVVDIRKKAERHFEVETEAGEIYTSKAVIIAIGAGIINP
                    ************************************************************

    COL             KQLDVKGVERYQLTNLHYVVQSYRRFKDKDVLISGGGNTALDWAHDIAKIAKSVTVVYRK
    N315            KQLDVKGVERYQLTNLHYVVQSYRRFKDKDVLISGGGNTALDWAHDIAKIAKSVTVVYRK
    NCTC8325        KQLDVKGVERYQLTNLHYVVQSYRRFKDKDVLISGGGNTALDWAHDIAKIAKSVTVVYRK
    Newman          KQLDVKGVERYQLTNLHYVVQSYRRFKDKDVLISGGGNTALDWAHDIAKIAKSVTVVYRK
    USA300_FPR3757  KQLDVKGVERYQLTNLHYVVQSYRRFKDKDVLISGGGNTALDWAHDIAKIAKSVTVVYRK
                    ************************************************************

    COL             EDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVI
    N315            EDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVI
    NCTC8325        EDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVI
    Newman          EDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVI
    USA300_FPR3757  EDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVI
                    ************************************************************

    COL             ISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAF
    N315            ISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAF
    NCTC8325        ISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAF
    Newman          ISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAF
    USA300_FPR3757  ISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAF
                    ************************************************************

    COL             SDGANAANLAKTYIQPDANAEGYVSSHHEVFKEANKTIVNKHLY
    N315            SDGANAANLAKTYIQPDANAEGYVSSHHEVFKEANKTIVNKHLY
    NCTC8325        SDGANAANLAKTYIQPDANAEGYVSSHHEVFKEANKTIVNKHLY
    Newman          SDGANAANLAKTYIQPDANAEGYVSSHHEVFKEANKTIVNKHLY
    USA300_FPR3757  SDGANAANLAKTYIQPDANAEGYVSSHHEVFKEANKTIVNKHLY
                    ********************************************