From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005896000
  • symbol?: cobI
  • description?: magnesium transporter CorA

      descriptions from strain specific annotations:

    • magnesium transporter CorA
    • CorA family protein
    • CorA-like Mg2+ transporter protein
    • Magnesium and cobalt transport protein corA
    • cationic membrane transport protein
    • cationic transporter
    • CorA family transporter
    • corA-like Mg2+ transporter family protein
    • Mg2+ transporter protein, CorA family protein
    • Mg2 transporter protein CorA family protein
    • MIT family metal ion transporter CorA
  • strand?: +
  • coordinates?: 5966040..5966984
  • synteny block?: BlockID0046410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2315 (corA)
    08BA02176:
    C248_2424
    11819-97:
    MS7_2395
    71193:
    ST398NM01_2431
    ECT-R 2:
    ECTR2_2237
    ED133:
    SAOV_2424
    ED98:
    SAAV_2442
    HO 5096 0412:
    SAEMRSA15_22770
    JH1:
    SaurJH1_2448
    JH9:
    SaurJH9_2402
    JKD6008:
    SAA6008_02415 (cobI)
    JKD6159:
    SAA6159_02280 (cobI)
    LGA251:
    SARLGA251_21620
    M013:
    M013TW_2338
    MRSA252:
    SAR2465
    MSHR1132:
    SAMSHR1132_22050
    MSSA476:
    SAS2268
    Mu3:
    SAHV_2360
    Mu50:
    SAV2376
    MW2:
    MW2298
    RF122:
    SAB2256
    ST398:
    SAPIG2431
    T0131:
    SAT0131_02567
    TCH60:
    HMPREF0772_10812
    TW20:
    SATW20_25080
    USA300_TCH1516:
    USA300HOU_2361
    VC40:
    SAVC_10750

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MITSFRHSEDIDKHIIKTPLDHTASWINVVEPDREEIENLMEQYNIPEDFIRDPLDSEES
    N315            MITSFRHSEDIDKHIIKTPLDHTASWINVVEPDREEIENLMEQYNIPEDFIRDPLDSEES
    NCTC8325        MITSFRHSEDIDKHIIKTPLDHTASWINVVEPDREEIENLMEQYNIPEDFIRDPLDSEES
    Newman          MITSFRHSEDIDKHIIKTPLDHTASWINVVEPDREEIENLMEQYNIPEDFIRDPLDSEES
    USA300_FPR3757  MITSFRHSEDIDKHIIKTPLDHTASWINVVEPDREEIENLMEQYNIPEDFIRDPLDSEES
                    ************************************************************

    COL             SRIEYDEDTGYSLIIIDLPIVNSTNRSVLSFVTIPLGIIIGNGIIVTVCDAENEFLENLP
    N315            SRIEYDEDTGYSLIIIDLPIVNSTNRSVLSFVTIPLGIIIGNGIIVTVCDAENEFLENLP
    NCTC8325        SRIEYDEDTGYSLIIIDLPIVNSTNRSVLSFVTIPLGIIIGNGIIVTVCDAENEFLENLP
    Newman          SRIEYDEDTGYSLIIIDLPIVNSTNRSVLSFVTIPLGIIIGNGIIVTVCDAENEFLENLP
    USA300_FPR3757  SRIEYDEDTGYSLIIIDLPIVNSTNRSVLSFVTIPLGIIIGNGIIVTVCDAENEFLENLP
                    ************************************************************

    COL             KRDINLKFHSRFALEILTTIADHYNRNLRLLNKSRIRIEKELKNNITNKQLFKLMEVEKS
    N315            KRDINLKFHSRFALEILTTIADHYNRNLRLLNKSRIRIEKELKNNITNKQLFKLMEVEKS
    NCTC8325        KRDINLKFHSRFALEILTTIADHYNRNLRLLNKSRIRIEKELKNNITNKQLFKLMEVEKS
    Newman          KRDINLKFHSRFALEILTTIADHYNRNLRLLNKSRIRIEKELKNNITNKQLFKLMEVEKS
    USA300_FPR3757  KRDINLKFHSRFALEILTTIADHYNRNLRLLNKSRIRIEKELKNNITNKQLFKLMEVEKS
                    ************************************************************

    COL             LVYFLAALKGNDTIIKKLFRLPAIKRFEEDEELLEDLIIENNQAIETTELHQRILESITT
    N315            LVYFLAALKGNDTIIKKLFRLPAIKRFEEDEELLEDLIIENNQAIETTELHQRILESITT
    NCTC8325        LVYFLAALKGNDTIIKKLFRLPAIKRFEEDEELLEDLIIENNQAIETTELHQRILESITT
    Newman          LVYFLAALKGNDTIIKKLFRLPAIKRFEEDEELLEDLIIENNQAIETTELHQRILESITT
    USA300_FPR3757  LVYFLAALKGNDTIIKKLFRLPAIKRFEEDEELLEDLIIENNQAIETTELHQRILESITT
                    ************************************************************

    COL             SYASLLSNDMNTIMKTLTLFTVLLTLPTLVFSFFGMNVPLPIDDHSYISWIIVVGISLIL
    N315            SYASLLSNDMNTIMKTLTLFTVLLTLPTLVFSFFGMNVPLPIDDHSYISWIIVVGISLIL
    NCTC8325        SYASLLSNDMNTIMKTLTLFTVLLTLPTLVFSFFGMNVPLPIDDHSYISWIIVVGISLIL
    Newman          SYASLLSNDMNTIMKTLTLFTVLLTLPTLVFSFFGMNVPLPIDDHSYISWIIVVGISLIL
    USA300_FPR3757  SYASLLSNDMNTIMKTLTLFTVLLTLPTLVFSFFGMNVPLPIDDHSYISWIIVVGISLIL
                    ************************************************************

    COL             VVIVSIFLWRKQKL
    N315            VVIVSIFLWRKQKL
    NCTC8325        VVIVSIFLWRKQKL
    Newman          VVIVSIFLWRKQKL
    USA300_FPR3757  VVIVSIFLWRKQKL
                    **************