From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005911000
  • symbol?: gltT
  • description?: proton/sodium-glutamate symport protein

      descriptions from strain specific annotations:

    • proton/sodium-glutamate symport protein
    • sodium:dicarboxylate symporter
    • Proton/glutamate symport protein
    • Sodium/glutamate symport protein
    • proton/sodium-glutamate symport protein (Glutamate-aspartate carrierprotein)
    • putative proton/sodium-glutamate symport protein
    • DAACS family dicarboxylate/amino acid:sodium (Na+) or proton (H+) symporter
    • proton, sodium-glutamate symport protein
    • DAACS family dicarboxylate/amino acid:sodium or proton symporter
    • proton/sodium-glutamate symporter
  • strand?: -
  • coordinates?: 5979555..5980799
  • synteny block?: BlockID0046550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2172 (gltT)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2321 (gltT)
    08BA02176:
    C248_2431 (gltT)
    11819-97:
    MS7_2401 (gltT)
    71193:
    ST398NM01_2437
    ECT-R 2:
    ECTR2_2243
    ED133:
    SAOV_2430c
    ED98:
    SAAV_2449
    HO 5096 0412:
    SAEMRSA15_22830 (gltT)
    JH1:
    SaurJH1_2455
    JH9:
    SaurJH9_2408
    JKD6008:
    SAA6008_02423 (gltT)
    JKD6159:
    SAA6159_02287 (gltT)
    LGA251:
    SARLGA251_21680 (gltT)
    M013:
    M013TW_2344
    MRSA252:
    SAR2472 (gltT)
    MSHR1132:
    SAMSHR1132_22120
    MSSA476:
    SAS2274
    Mu3:
    SAHV_2368 (gltT)
    Mu50:
    SAV2384 (gltT)
    MW2:
    MW2304 (gltT)
    RF122:
    SAB2263c (gltT)
    ST398:
    SAPIG2437
    T0131:
    SAT0131_02574
    TCH60:
    HMPREF0772_10804 (gltT)
    TW20:
    SATW20_25140 (gltT)
    USA300_TCH1516:
    USA300HOU_2366 (gltT)
    VC40:
    SAVC_10785

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALFKRKISLPMQVVIALVLGVVVGLLLYGQENVANYIKPFGDVFLNLIKMIVIPVVFCS
    N315            MALFKRKISLPMQVVIALVLGVVVGLLLYGQENVANYIKPFGDVFLNLIKMIVIPVVFCS
    NCTC8325        MALFKRKISLPMQVVIALVLGVVVGLLLYGQENVANYIKPFGDVFLNLIKMIVIPVVFCS
    Newman          MALFKRKISLPMQVVIALVLGVVVGLLLYGQENVANYIKPFGDVFLNLIKMIVIPVVFCS
    USA300_FPR3757  MALFKRKISLPMQVVIALVLGVVVGLLLYGQENVANYIKPFGDVFLNLIKMIVIPVVFCS
                    ************************************************************

    COL             LALSISNVGESKTVGRYGWKTILYFEIITTIAIGLGIIFGNLFKPGAGLDPTKLPKGDIS
    N315            LALSISNVGESKTVGRYGWKTILYFEIITTIAIGLGIIFGNLFKPGAGLDPTKLPKGDIS
    NCTC8325        LALSISNVGESKTVGRYGWKTILYFEIITTIAIGLGIIFGNLFKPGAGLDPTKLPKGDIS
    Newman          LALSISNVGESKTVGRYGWKTILYFEIITTIAIGLGIIFGNLFKPGAGLDPTKLPKGDIS
    USA300_FPR3757  LALSISNVGESKTVGRYGWKTILYFEIITTIAIGLGIIFGNLFKPGAGLDPTKLPKGDIS
                    ************************************************************

    COL             KYQSTAHAAEQSTYGNHFIDTIVHIIPTNFFEALNKGELLPIIFFAVFFGLGLAAVGKKA
    N315            KYQSTAHAAEQSTYGNHFIDTIVHIIPTNFFEALNKGELLPIIFFAVFFGLGLAAVGKKA
    NCTC8325        KYQSTAHAAEQSTYGNHFIDTIVHIIPTNFFEALNKGELLPIIFFAVFFGLGLAAVGKKA
    Newman          KYQSTAHAAEQSTYGNHFIDTIVHIIPTNFFEALNKGELLPIIFFAVFFGLGLAAVGKKA
    USA300_FPR3757  KYQSTAHAAEQSTYGNHFIDTIVHIIPTNFFEALNKGELLPIIFFAVFFGLGLAAVGKKA
                    ************************************************************

    COL             EPVKEFLSGSLEAVFWMINKILKLAPLGVFAFICTTIITFGASALLPLLKLVLVVVFAMV
    N315            EPVKEFLSGSLEAVFWMINKILKLAPLGVFAFICTTIITFGASALLPLLKLVLVVVFAMV
    NCTC8325        EPVKEFLSGSLEAVFWMINKILKLAPLGVFAFICTTIITFGASALLPLLKLVLVVVFAMV
    Newman          EPVKEFLSGSLEAVFWMINKILKLAPLGVFAFICTTIITFGASALLPLLKLVLVVVFAMV
    USA300_FPR3757  EPVKEFLSGSLEAVFWMINKILKLAPLGVFAFICTTIITFGASALLPLLKLVLVVVFAMV
                    ************************************************************

    COL             FFVFAILGLVAWMCGINIMNIIRILKSELLLAFSTSSSEAVLPVMMKKMENFGSPKEITS
    N315            FFVFAILGLVAWMCGINIMNIIRILKSELLLAFSTSSSEAVLPVMMKKMENFGSPKEITS
    NCTC8325        FFVFAILGLVAWMCGINIMNIIRILKSELLLAFSTSSSEAVLPVMMKKMENFGSPKEITS
    Newman          FFVFAILGLVAWMCVINIMNIIRILKSELLLAFSTSSSEAVLPVMMKKMENFGSPKEITS
    USA300_FPR3757  FFVFAILGLVAWMCGINIMNIIRILKSELLLAFSTSSSEAVLPVMMKKMENFGSPKEITS
                    ************** *********************************************

    COL             FVIPIGYTFNLDGSALYQSIAALFVAQMYGMHLTLSEQIVLMLTLMITSKGMAAVPGTSI
    N315            FVIPIGYTFNLDGSALYQSIAALFVAQMYGMHLTLSEQIVLMLTLMITSKGMAAVPGTSI
    NCTC8325        FVIPIGYTFNLDGSALYQSIAALFVAQMYGMHLTLSEQIVLMLTLMITSKGMAAVPGTSI
    Newman          FVIPIGYTFNLDGSALYQSIAALFVAQMYGMHLTLSEQIVLMLTLMITSKGMAAVPGTSI
    USA300_FPR3757  FVIPIGYTFNLDGSALYQSIAALFVAQMYGMHLTLSEQIVLMLTLMITSKGMAAVPGTSI
                    ************************************************************

    COL             VVLLTTLGAMGLPAQGLALIIGVDRILDMVRTCVNVIGNALSTIVIAKWENVYDKAKGQE
    N315            VVLLTTLGAMGLPAQGLALIIGVDRILDMVRTCVNVIGNALSTIVIAKWENVYDKAKGQE
    NCTC8325        VVLLTTLGAMGLPAQGLALIIGVDRILDMVRTCVNVIGNALSTIVIAKWENVYDKAKGQE
    Newman          VVLLTTLGAMGLPAQGLALIIGVDRILDMVRTCVNVIGNALSTIVIAKWENVYDKAKGQE
    USA300_FPR3757  VVLLTTLGAMGLPAQGLALIIGVDRILDMVRTCVNVIGNALSTIVIAKWENVYDKAKGQE
                    ************************************************************

    COL             YLKSI
    N315            YLKSI
    NCTC8325        YLKSI
    Newman          YLKSI
    USA300_FPR3757  YLKSI
                    *****