From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan005912000
  • symbol?:
  • description?: exported protein
  • strand?: -
  • coordinates?: 5981022..5981387
  • synteny block?: BlockID0046560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2322
    08BA02176:
    C248_2432
    11819-97:
    MS7_2402
    71193:
    ST398NM01_2438
    ECT-R 2:
    ECTR2_2244
    ED133:
    SAOV_2431c
    ED98:
    SAAV_2450
    HO 5096 0412:
    SAEMRSA15_22840
    JH1:
    SaurJH1_2456
    JH9:
    SaurJH9_2409
    JKD6008:
    SAA6008_02424
    JKD6159:
    SAA6159_02288
    LGA251:
    SARLGA251_21690
    M013:
    M013TW_2345
    MRSA252:
    SAR2473
    MSHR1132:
    SAMSHR1132_22130
    MSSA476:
    SAS2275
    Mu3:
    SAHV_2369
    Mu50:
    SAV2385
    MW2:
    MW2305
    RF122:
    SAB2264c
    ST398:
    SAPIG2438
    T0131:
    SAT0131_02575
    TCH60:
    HMPREF0772_10803
    TW20:
    SATW20_25150
    USA300_TCH1516:
    USA300HOU_2367
    VC40:
    SAVC_10790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKKNAIKVIIILFISLIVAVAFFFGLKTYQGHKNIQLIDSYLEEKNLKDKIKSEKTEY
    N315            MKKKKNAIKVIIILFISLIVAVAFFFGLKTYQGHKNIQLIDSYLEEKNLKDKIKSEKTEY
    NCTC8325        MKKKKNAIKVIIILFISLIVAVAFFFGLKTYQGHKNIQLIDSYLEEKNLKDKIKSEKTEY
    Newman          MKKKKNAIKVIIILFISLIVAVAFFFGLKTYQGHKNIQLIDSYLEEKNLKDKIKSEKTEY
    USA300_FPR3757  MKKKKNAIKVIIILFISLIVAVAFFFGLKTYQGHKNIQLIDSYLEEKNLKDKIKSEKTEY
                    ************************************************************

    COL             SAKKGLFYKEVTFKDEPGVTYVVQPISTNKGLFVEGFDTETKKSLKTAKHKYFNQNYKPS
    N315            SAKKGLFYKEVTFKDEPGVTYVVQPISTNKGLFVEGFDTETKKSLKTAKHKYFNQNYKPS
    NCTC8325        SAKKGLFYKEVTFKDEPGVTYVVQPISTNKGLFVEGFDTETKKSLKTAKHKYFNQNYKPS
    Newman          SAKKGLFYKEVTFKDEPGVTYVVQPISTNKGLFVEGFDTETKKSLKTAKHKYFNQNYKPS
    USA300_FPR3757  SAKKGLFYKEVTFKDEPGVTYVVQPISTNKGLFVEGFDTETKKSLKTAKHKYFNQNYKPS
                    ************************************************************

    COL             K
    N315            K
    NCTC8325        K
    Newman          K
    USA300_FPR3757  K
                    *