From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005915000
  • symbol?: narK
  • description?: nitrite extrusion protein

      descriptions from strain specific annotations:

    • nitrite extrusion protein
    • MFS transporter
    • nitrate transporter NarT
    • nitrite transport protein
    • nitrite extrusion protein NarK
    • major facilitator superfamily nitrate:nitrite antiporter
    • major facilitator transporter
    • MFS family major facilitator transporter, nitrate:nitrite antiporter
    • Nitrate/nitrite transporter
    • nitrite extrusion protein (Nitrite facilitator)
    • putative nitrate transporter narT
  • strand?: -
  • coordinates?: 5983012..5984184
  • synteny block?: BlockID0046590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2176 (narK)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2325 (narK)
    08BA02176:
    C248_2435 (narT)
    11819-97:
    MS7_2405 (narT)
    71193:
    ST398NM01_2441
    ECT-R 2:
    ECTR2_2247
    ED133:
    SAOV_2434c
    ED98:
    SAAV_2453
    HO 5096 0412:
    SAEMRSA15_22870 (narT)
    JH1:
    SaurJH1_2459
    JH9:
    SaurJH9_2412
    JKD6008:
    SAA6008_02427 (narK)
    JKD6159:
    SAA6159_02291 (narK)
    LGA251:
    SARLGA251_21720 (narT)
    M013:
    M013TW_2348
    MRSA252:
    SAR2476 (narT)
    MSHR1132:
    SAMSHR1132_22160
    MSSA476:
    SAS2278
    Mu3:
    SAHV_2372 (narK)
    Mu50:
    SAV2388 (narK)
    MW2:
    MW2308 (narK)
    RF122:
    SAB2267c (narT)
    ST398:
    SAPIG2441
    T0131:
    SAT0131_02578 (ileS)
    TCH60:
    HMPREF0772_10800 (narK)
    TW20:
    SATW20_25180 (narT)
    USA300_TCH1516:
    USA300HOU_2369 (narK)
    VC40:
    SAVC_10805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
    N315            MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
    NCTC8325        MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
    Newman          MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
    USA300_FPR3757  MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
                    ************************************************************

    COL             VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
    N315            VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
    NCTC8325        VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
    Newman          VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
    USA300_FPR3757  VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
                    ************************************************************

    COL             PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
    N315            PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
    NCTC8325        PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
    Newman          PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
    USA300_FPR3757  PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
                    ************************************************************

    COL             GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
    N315            GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
    NCTC8325        GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
    Newman          GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
    USA300_FPR3757  GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
                    ************************************************************

    COL             AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALFTVGCL
    N315            AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCL
    NCTC8325        AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALFTVGCL
    Newman          AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALFTVGCL
    USA300_FPR3757  AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVVMIIGAIILGISDHIALFTVGCL
                    *************************************:*****:****************

    COL             TISICAGIGNGLIFKLVPSYFLNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
    N315            TISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
    NCTC8325        TISICAGIGNGLIFKLVPSYFLNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
    Newman          TISICAGIGNGLIFKLVPSYFLNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
    USA300_FPR3757  TISICAGIGNGLIFKLVPSYFLNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
                    ********************* **************************************

    COL             FIFLAVFGCIALFTMRHLYQKEYGSLKNG
    N315            FIFLAVFGCIALFTMRHLYQKEYGSLKHS
    NCTC8325        FIFLAVFGCIALFTMRHLYQKEYGSLKNG
    Newman          FIFLAVFGCIALFTMRHLYQKEYGSLKNG
    USA300_FPR3757  FIFLAVFGCIALFTMRHLYQKEYGSLKNG
                    ***************************:.