From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005918000
  • symbol?:
  • description?: Zn-dependent protease-like protein

      descriptions from strain specific annotations:

    • Zn-dependent protease-like protein
    • pseudogene
  • strand?: +
  • coordinates?: 5984795..5985319
  • synteny block?: BlockID0046620
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2326
    08BA02176:
    C248_2436
    11819-97:
    71193:
    ST398NM01_2442
    ECT-R 2:
    ECTR2_2248
    ED133:
    SAOV_2435
    ED98:
    SAAV_2454
    HO 5096 0412:
    SAEMRSA15_22880
    JH1:
    SaurJH1_2461
    JH9:
    SaurJH9_2413
    JKD6008:
    SAA6008_02430
    JKD6159:
    LGA251:
    M013:
    M013TW_2349
    MRSA252:
    SAR2477
    MSHR1132:
    SAMSHR1132_22170
    MSSA476:
    SAS2279
    Mu3:
    SAHV_2373
    Mu50:
    SAV2389
    MW2:
    MW2310
    RF122:
    SAB2268
    ST398:
    SAPIG2442
    T0131:
    SAT0131_02579
    TCH60:
    HMPREF0772_10798
    TW20:
    SATW20_25190
    USA300_TCH1516:
    USA300HOU_2371
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MYKINIIRSDSVYKNILKAPINDRDSIFTKEILVPFKKKFEVQHMPIYNDDKQTMSAIQF
    Newman          MYKINIIRSDSVYNNILKAPINDRDSIFTKEILVPFKKKFEVQHMPIYNDDKQTMSAIQF
    USA300_FPR3757  MYKINIIRSDSVYNNILKAPINDRDSIFTKEILVPFKKKFEVQHMPIYNDDKQTMSAIQF
                    *************:**********************************************

    N315            LDAFQISPKDLRMSDQMSIQYLNNDFWSNCEKYLKVAIDQFSNYSISSQVSNYHFTVLLG
    Newman          LDAFQISPKDLRMSDQMSIQYLNNDFWSNCEKYLKVAIDQFSNYSISSQVSNYHFTVLLG
    USA300_FPR3757  LDAFQISPKDLRMSDQMSIQYLNNDFWSNCEKYLKVAIDQFSNYSISSQVSNYHFTVLLG
                    ************************************************************

    N315            DSQKPLMYLNKNRGGDGGIPGYIMIYLVPSTSTINSMKSLIAHEVNHNMRYQYIDWDGGS
    Newman          DRQKPLMYLNKNRGGDGGIPGYIMIYLVPSTSTINSMKSLIAHEVNHNMRYQYIDWDGGS
    USA300_FPR3757  DRQKPLMYLNKNRGGDGGIPGYIMIYLVPSTSTINSMKSLIAHEVNHNMRYQYIDWDGGS
                    * **********************************************************

    N315            LIELIIAEGLAENYVESLYGKAHIGPWVTNTNWSRDNVKIKNTIYNHLHLKHIFESMPYL
    Newman          LIELIIAEGLAENYVESLYGKAHIGPWVTNTN----------------------------
    USA300_FPR3757  LIELIIAEGLAENYVESLYGKAHIGPWVTNTN----------------------------
                    ********************************                            

    N315            YGDDINKLQGRPIVGLSHAAGYACGYHLVKYFLQKTNIPIEVATTLPAQKIINEVTEFWH
    Newman          ------------------------------------------------------------
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    N315            THTL
    Newman          ----
    USA300_FPR3757  ----