From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005923000
  • symbol?: nreB
  • description?: sensory box histidine kinase, putative

      descriptions from strain specific annotations:

    • sensory box histidine kinase, putative
    • two-component sensor histidine kinase
    • ATPase
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • oxygen sensor histidine kinase NreB
    • roxygen sensor histidine kinase NreB
    • Sensor protein DegS
    • two component system histidine kinase
    • putative histidine kinase
  • strand?: -
  • coordinates?: 5987564..5988598
  • synteny block?: BlockID0046670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2329
    08BA02176:
    C248_2439
    11819-97:
    MS7_2407 (nreB)
    71193:
    ST398NM01_2445
    ECT-R 2:
    ECTR2_2251
    ED133:
    SAOV_2438c
    ED98:
    SAAV_2457
    HO 5096 0412:
    SAEMRSA15_22910
    JH1:
    SaurJH1_2464
    JH9:
    SaurJH9_2416
    JKD6008:
    SAA6008_02433 (nreB)
    JKD6159:
    SAA6159_02293 (nreB)
    LGA251:
    SARLGA251_21740 (nreB)
    M013:
    M013TW_2353
    MRSA252:
    SAR2481
    MSHR1132:
    SAMSHR1132_22200
    MSSA476:
    SAS2283
    Mu3:
    SAHV_2376
    Mu50:
    SAV2392
    MW2:
    MW2314
    RF122:
    SAB2271c
    ST398:
    SAPIG2445
    T0131:
    SAT0131_02583
    TCH60:
    HMPREF0772_10795 (nreB)
    TW20:
    SATW20_25220 (nreB)
    USA300_TCH1516:
    USA300HOU_2374
    VC40:
    SAVC_10830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINEDSIQLDTLLKKYYEHSIEKIVFADDNGKIIAMNDAAKDILSEEDNYSAVANAICHR
    N315            MINEDSIQLDTLLKKYYEHSIEKIVFADDNGKIIAMNDAAKDILSEEDNYSAVANAICHR
    NCTC8325        MINEDSIQLDTLLKKYYEHSIEKIVFADDNGKIIAMNDAAKDILSEEDNYSAVANAICHR
    Newman          MINEDSIQLDTLLKKYYEHSIEKIVFADDNGKIIAMNDAAKDILSEEDNYSAVANAICHR
    USA300_FPR3757  MINEDSIQLDTLLKKYYEHSIEKIVFADDNGKIIAMNDAAKDILSEEDNYSAVANAICHR
                    ************************************************************

    COL             CEGYTNAYDVQSCKDCFLESMQVQATNFQVFMKTKDQKVMPFTATYQLIDQDRGIHAFTL
    N315            CEGYTNAYDVQSCKDCFLESMQVQATNFQVFMKTKDQKVMPFTATYQLIDQDRGIHAFTL
    NCTC8325        CEGYTNAYDVQSCKDCFLESMQVQATNFQVFMKTKDQKVMPFTATYQLIDQDRGIHAFTL
    Newman          CEGYTNAYDVQSCKDCFLESMQVQATNFQVFMKTKDQKVMPFTATYQLIDQDRGIHAFTL
    USA300_FPR3757  CEGYTNAYDVQSCKDCFLESMQVQATNFQVFMKTKDQKVMPFTATYQLIDQDRGIHAFTL
                    ************************************************************

    COL             QNVSSQIEQQEKLHQQRMMRKTISAQENERKRISRELHDSVIQEMLNVDVQLRLLKYQED
    N315            QNVSSQIEQQEKLHQQRMMRKTISAQENERKRISRELHDSVIQEMLNVDVQLRLLKYQED
    NCTC8325        QNVSSQIEQQEKLHQQRMMRKTISAQENERKRISRELHDSVIQEMLNVDVQLRLLKYQED
    Newman          QNVSSQIEQQEKLHQQRMMRKTISAQENERKRISRELHDSVIQEMLNVDVQLRLLKYQED
    USA300_FPR3757  QNVSSQIEQQEKLHQQRMMRKTISAQENERKRISRELHDSVIQEMLNVDVQLRLLKYQED
                    ************************************************************

    COL             TTKLLEDAENIEYIVAKLIDDIRNMSVELRPASLDDLGLEAAFKSYFKQFEENYGIKIIY
    N315            TTKLLEDAENIEYIVAKLIDDIRNMSVELRPASLDDLGLEAAFKSYFKQFEENYGIKIIY
    NCTC8325        TTKLLEDAENIEYIVAKLIDDIRNMSVELRPASLDDLGLEAAFKSYFKQFEENYGIKIIY
    Newman          TTKLLEDAENIEYIVAKLIDDIRNMSVELRPASLDDLGLEAAFKSYFKQFEENYGIKIIY
    USA300_FPR3757  TTKLLEDAENIEYIVAKLIDDIRNMSVELRPASLDDLGLEAAFKSYFKQFEENYGIKIIY
                    ************************************************************

    COL             TSNIKNTRFDSDIETVVYRVVQEAILNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFD
    N315            TSNIKNTRFDSDIETVVYRVVQEAILNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFD
    NCTC8325        TSNIKNTRFDSDIETVVYRVVQEAILNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFD
    Newman          TSNIKNTRFDSDIETVVYRVVQEAILNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFD
    USA300_FPR3757  TSNIKNTRFDSDIETVVYRVVQEAILNALKYADVNEINVGIRQTGRHLVAEVIDAGNGFD
                    ************************************************************

    COL             PSSKPKGSGLGLYGMNERAELVSGSVNIETKIGEGTNVTLNIPI
    N315            PSSKPKGSGLGLYGMNERAELVSGSVNIETKIGEGTNVTLNIPI
    NCTC8325        PSSKPKGSGLGLYGMNERAELVSGSVNIETKIGEGTNVTLNIPI
    Newman          PSSKPKGSGLGLYGMNERAELVSGSVNIETKIGEGTNVTLNIPI
    USA300_FPR3757  PSSKPKGSGLGLYGMNERAELVSGSVNIETKIGEGTNVTLNIPI
                    ********************************************