From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005928000
  • symbol?: narG
  • description?: nitrate reductase subunit alpha

      descriptions from strain specific annotations:

    • nitrate reductase subunit alpha
    • respiratory nitrate reductase subunit alpha
    • nitrate reductase, alpha subunit
    • respiratory nitrate reductase, alpha subunit
    • respiratory nitrate reductase alpha chain
    • nitrate reductase alpha subunit
    • pseudogene
  • strand?: -
  • coordinates?: 5991881..5995628
  • synteny block?: BlockID0046720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2395 (narG)
    N315:
    SA2185 (narG)
    NCTC8325:
    Newman:
    NWMN_2297 (narG)
    USA300_FPR3757:
    04-02981:
    SA2981_2334 (narG)
    08BA02176:
    C248_2444 (narG)
    11819-97:
    MS7_2412
    71193:
    ST398NM01_2450
    ECT-R 2:
    ECTR2_2256
    ED133:
    SAOV_2442c
    ED98:
    SAAV_2462 (narG)
    HO 5096 0412:
    SAEMRSA15_22960 (narG)
    JH1:
    SaurJH1_2469
    JH9:
    SaurJH9_2421
    JKD6008:
    SAA6008_02438 (narG)
    JKD6159:
    SAA6159_02298 (narG)
    LGA251:
    SARLGA251_21790 (narG)
    M013:
    M013TW_2358
    MRSA252:
    SAR2486 (narG)
    MSHR1132:
    SAMSHR1132_22250
    MSSA476:
    SAS2288
    Mu3:
    SAHV_2381 (narG)
    Mu50:
    SAV2397 (narG)
    MW2:
    MW2319 (narG)
    RF122:
    SAB2276c (narG)
    ST398:
    SAPIG2450
    T0131:
    SAT0131_02588
    TCH60:
    HMPREF0772_10790 (narG)
    TW20:
    SATW20_25270 (narG)
    USA300_TCH1516:
    USA300HOU_2379 (narG)
    VC40:
    SAVC_10855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKFGLNFFKPTEKFNGNWSILESKSREWEKMYRERWSHDKEVRTTHGVNCTGSCSWKVF
    N315            MGKFGLNFFKPTEKFNGNWSILESKSREWEKMYRERWSHDKEVRTTHGVNCTGSCSWKVF
    NCTC8325        MGKFGLNFFKPTEKFNGNWSILESKSREWEKMYRERWSHDKEVRTTHGVNCTGSCSWKVF
    Newman          MGKFGLNFFKPTEKFNGNWSILESKSREWEKMYRERWSHDKEVRTTHGVNCTGSCSWKVF
    USA300_FPR3757  MGKFGLNFFKPTEKFNGNWSILESKSREWEKMYRERWSHDKEVRTTHGVNCTGSCSWKVF
                    ************************************************************

    COL             VKNGVITWENQQTDYPSCGPDMPEYEPRGCPRGASFSWYEYSPLRIKYPYIRGKLWDLWT
    N315            VKNGVITWENQQTDYPSCGPDMPEYEPRGCPRGASFSWYEYSPLRIKYPYIRGKLWDLWT
    NCTC8325        VKNGVITWENQQTDYPSCGPDMPEYEPRGCPRGASFSWYEYSPLRIKYPYIRGKLWDLWT
    Newman          VKNGVITWENQQTDYPSCGPDMPEYEPRGCPRGASFSWYEYSPLRIKYPYIRGKLWDLWT
    USA300_FPR3757  VKNGVITWENQQTDYPSCGPDMPEYEPRGCPRGASFSWYEYSPLRIKYPYIRGKLWDLWT
                    ************************************************************

    COL             EALEENNGNRVAAWASIVENEDKAKQYKQARGMGGHVRSNWKDVTEIIAAQLLYTIKKYG
    N315            EALEENYGNRVAAWASIVENEDKAKQYKQARGMGGHVRSNWKDVTEIIAAQLLYTIKKYG
    NCTC8325        EALEENNGNRVAAWASIVENEDKAKQYKQARGMGGHVRSNWKDVTEIIAAQLLYTIKKYG
    Newman          EALEENNGNRVAAWASIVENEDKAKQYKQARGMGGHVRSNWKDVTEIIAAQLLYTIKKYG
    USA300_FPR3757  EALEENNGNRVAAWASIVENEDKAKQYKQARGMGGHVRSNWKDVTEIIAAQLLYTIKKYG
                    ****** *****************************************************

    COL             PDRIAGFTPIPAMSMISYAAGARFINLLGGEMLSFYDWYADLPPASPQIWGEQTDVPESS
    N315            PDRIAGFTPIPAMSMISYAAGARFINLLGGEMLSFYDWYADLPPASPQIWGEQTDVPESS
    NCTC8325        PDRIAGFTPIPAMSMISYAAGARFINLLGGEMLSFYDWYADLPPASPQIWGEQTDVPESS
    Newman          PDRIAGFTPIPAMSMISYAAGARFINLLGGEMLSFYDWYADLPPASPQIWGEQTDVPESS
    USA300_FPR3757  PDRIAGFTPIPAMSMISYAAGARFINLLGGEMLSFYDWYADLPPASPQIWGEQTDVPESS
                    ************************************************************

    COL             DWYNASYIIMWGSNVPLTRTPDAHFMTEVRYKGTKVISVAPDYAENVKFADNWLAPNPGS
    N315            DWYNASYIIMWGSNVPLTRTPDAHFMTEVRYKGTKVISVAPDYAENVKFADNWLAPNPGS
    NCTC8325        DWYNASYIIMWGSNVPLTRTPDAHFMTEVRYKGTKVISVAPDYAENVKFADNWLAPNPGS
    Newman          DWYNASYIIMWGSNVPLTRTPDAHFMTEVRYKGTKVISVAPDYAENVKFADNWLAPNPGS
    USA300_FPR3757  DWYNASYIIMWGSNVPLTRTPDAHFMTEVRYKGTKVISVAPDYAENVKFADNWLAPNPGS
                    ************************************************************

    COL             DAAIAQAMTHVILQEHYVNQPNERFINYAKQYTDMPFLIMLDEDENGYKAGRFLRASDLG
    N315            DAAIAQAMTHVILQEHYVNQPNERFINYAKQYTDMPFLIMLDEDENGYKAGRFLRASDLG
    NCTC8325        DAAIAQAMTHVILQEHYVNQPNERFINYAKQYTDMPFLIMLDEDENGYKAGRFLRASDLG
    Newman          DAAIAQAMTHVILQEHYVNQPNERFINYAKQYTDMPFLIMLDEDENGYKAGRFLRASDLG
    USA300_FPR3757  DAAIAQAMTHVILQEHYVNQPNERFINYAKQYTDMPFLIMLDEDENGYKAGRFLRASDLG
                    ************************************************************

    COL             QTTEQGEWKPVIHDAISDSLVVPNGTMGQRWEEGKKWNLKLETEDGSKINPTLSMTEGGY
    N315            QTTEQGEWKPVIHDAISDSLVVPNGTMGQRWEEGKKWNLKLETEDGSKINPTLSMAEGGY
    NCTC8325        QTTEQGEWKPVIHDAISDSLVVPNGTMGQRWEEGKKWNLKLETEDGSKINPTLSMTEGGY
    Newman          QTTEQGEWKPVIHDAISDSLVVPNGTMGQRWEEGKKWNLKLETEDGSKINPTLSMTEGGY
    USA300_FPR3757  QTTEQGEWKPVIHDAISDSLVVPNGTMGQRWEEGKKWNLKLETEDGSKINPTLSMTEGGY
                    *******************************************************:****

    COL             ELETIQFPYFDSDGDGIFNRPIPTRQVTLANGDKVRIATIFDLMASQYGVRRFDHKLESK
    N315            ELETIQFPYFDSDGDGIFNRPIPTRQVTLANGDKVRIATIFDLMASQYGVRRFDHKLESK
    NCTC8325        ELETIQFPYFDSDGDGIFNRPIPTRQVTLANGDKVRIATIFDLMASQYGVRRFDHKLESK
    Newman          ELETIQFPYFDSDGDGIFNRPIPTRQVTLANGDKVRIATIFDLMASQYGVRRFDHKLESK
    USA300_FPR3757  ELETIQFPYFDSDGDGIFNRPIPTRQVTLANGDKVRIATIFDLMASQYGVRRFDHKLESK
                    ************************************************************

    COL             GYDDAESKYTPAWQEAISGVKQSVVIQVAKEFAQNAIDTEGRSMIIMGAGINHWFNSDTI
    N315            GYDDAESKYTPAWQEAISGVKQSVVIQVAKEFAQNAIDTEGRSMIIMGAGINHWFNSDTI
    NCTC8325        GYDDAESKYTPAWQEAISGVKQSVVIQVAKEFAQNAIDTEGRSMIIMGAGINHWFNSDTI
    Newman          GYDDAESKYTPAWQEAISGVKQSVVIQVAKEFAQNAIDTEGRSMIIMGAGINHWFNSDTI
    USA300_FPR3757  GYDDAESKYTPAWQEAISGVKQSVVIQVAKEFAQNAIDTEGRSMIIMGAGINHWFNSDTI
                    ************************************************************

    COL             YRSILNLVMLCGCQGVNGGGWAHYVGQEKCRPIEGWSTVAFAKDWQGPPRLQNGTSWFYF
    N315            YRSILNLVMLCGCQGVNGGGWAHYVGQEKCRPIEGWSTVAFAKDWQGPPRLQNGTSWFYF
    NCTC8325        YRSILNLVMLCGCQGVNGGGWAHYVGQEKCRPIEGWSTVAFAKDWQGPPRLQNGTSWFYF
    Newman          YRSILNLVMLCGCQGVNGGGWAHYVGQEKCRPIEGWSTVAFAKDWQGPPRLQNGTSWFYF
    USA300_FPR3757  YRSILNLVMLCGCQGVNGGGWAHYVGQEKCRPIEGWSTVAFAKDWQGPPRLQNGTSWFYF
                    ************************************************************

    COL             ATDQWKYEESNVDRLKSPLAKTEELKHQHPADYNVLAARLGWLPSYPQFNKNSLLFAEEA
    N315            ATDQWKYEESNVDRLKSPLAKTEDLKHQHPADYNVLAARLGWLPSYPQFNKNSLLFAEEA
    NCTC8325        ATDQWKYEESNVDRLKSPLAKTEELKHQHPADYNVLAARLGWLPSYPQFNKNSLLFAEEA
    Newman          ATDQWKYEESNVDRLKSPLAKTEELKHQHPADYNVLAARLGWLPSYPQFNKNSLLFAEEA
    USA300_FPR3757  ATDQWKYEESNVDRLKSPLAKTEELKHQHPADYNVLAARLGWLPSYPQFNKNSLLFAEEA
                    ***********************:************************************

    COL             KDEGIDSNEAILQRAIDEVKSKQTQFAIEDPDLKKNHPKSLFIWRSNLISSSAKGQEYFM
    N315            KDEGIESNEAILKRAINEVKSKQTQFAIEDPDLKKNHPKSLFIWRSNLISSSAKGQEYFM
    NCTC8325        KDEGIDSNEAILQRAIDEVKSKQTQFAIEDPDLKKNHPKSLFIWRSNLISSSAKGQEYFM
    Newman          KDEGIDSNEAILQRAIDEVKSKQTQFAIEDPDLKKNHPKSLFIWRSNLISSSAKGQEYFM
    USA300_FPR3757  KDEGIDSNEAILQRAIDEVKSKQTQFAIEDPDLKKNHPKSLFIWRSNLISSSAKGQEYFM
                    *****:******:***:*******************************************

    COL             KHLLGTKSGLLATPNEDEKPEEITWREETTGKLDLVVSLDFRMTATPLYSDIVLPAATWY
    N315            KHLLGTKSGLLATPNEDEKPEEITWREETTGKLDLVVSLDFRMTATPLYSDIVLPAATWY
    NCTC8325        KHLLGTKSGLLATPNEDEKPEEITWREETTGKLDLVVSLDFRMTATPLYSDIVLPAATWY
    Newman          KHLLGTKSGLLATPNEDEKPEEITWREETTGKLDLVVSLDFRMTATPLYSDIVLPAATWY
    USA300_FPR3757  KHLLGTKSGLLATPNEDEKPEEITWREETTGKLDLVVSLDFRMTATPLYSDIVLPAATWY
                    ************************************************************

    COL             EKHDLSSTDMHPYVHPFNPAIDPLWESRSDWDIYKTLAKAFSEMAKDYLPGTFKDVVTTP
    N315            EKHDLSSTDMHPYVHPFNPAIDPLWESRSDWDIYKTLAKAFSEMAKDYLPGTFKDVVTTP
    NCTC8325        EKHDLSSTDMHPYVHPFNPAIDPLWESRSDWDIYKTLAKAFSEMAKDYLPGTFKDVVTTP
    Newman          EKHDLSSTDMHPYVHPFNPAIDPLWESRSDWDIYKTLAKAFSEMAKDYLPGTFKDVVTTP
    USA300_FPR3757  EKHDLSSTDMHPYVHPFNPAIDPLWESRSDWDIYKTLAKAFSEMAKDYLPGTFKDVVTTP
                    ************************************************************

    COL             LSHDTKQEISTPYGVVKDWSKGEIEAVPGRTMPNFAIVERDYTKIYDKYVTLGPVLEKGK
    N315            LSHDTKQEISTPYGVVKDWSKGEIEAVPGRTMPNFAIVERDYTKIYDKYVTLGPVLEKGK
    NCTC8325        LSHDTKQEISTPYGVVKDWSKGEIEAVPGRTMPNFAIVERDYTKIYDKYVTLGPVLEKGK
    Newman          LSHDTKQEISTPYGVVKDWSKGEIEAVPGRTMPNFAIVERDYTKIYDKYVTLGPVLEKGK
    USA300_FPR3757  LSHDTKQEISTPYGVVKDWSKGEIEAVPGRTMPNFAIVERDYTKIYDKYVTLGPVLEKGK
                    ************************************************************

    COL             VGAHGVSFGVSEQYEELKSMLGTWSDTNDDSVRANRPRIDTARNVADAILSISSATNGKL
    N315            VGAHGVSFGVSEQYEELKSMLGTWSDTNDDSVRANRPRIDTARNVADAILSISSATNGKL
    NCTC8325        VGAHGVSFGVSEQYEELKSMLGTWSDTNDDSVRANRPRIDTARNVADAILSISSATNGKL
    Newman          VGAHGVSFGVSEQYEELKSMLGTWSDTNDDSVRANRPRIDTARNVADAILSISSATNGKL
    USA300_FPR3757  VGAHGVSFGVSEQYEELKSMLGTWSDTNDDSVRANRPRIDTARNVADAILSISSATNGKL
                    ************************************************************

    COL             SQKSYEDLEEQTGMPLKDISSERAAEKISFLNITSQPREVIPTAVFPGSNKQGRRYSPFT
    N315            SQKSYEDLEEQTGMPLKDISSERAAEKISFLNITSQPREVIPTAVFPGSNKQGRRYSPFT
    NCTC8325        SQKSYEDLEEQTGMPLKDISSERAAEKISFLNITSQPREVIPTAVFPGSNKQGRRYSPFT
    Newman          SQKSYEDLEEQTGMPLKDISSERAAEKISFLNITSQPREVIPTAVFPGSNKQGRRYSPFT
    USA300_FPR3757  SQKSYEDLEEQTGMPLKDISSERAAEKISFLNITSQPREVIPTAVFPGSNKQGRRYSPFT
                    ************************************************************

    COL             TNIERLVPFRTLTGRQSYYVDHEVFQQFGESLPVYKPTLPPMVFGNRDKKIKGGTDALVL
    N315            TNIERLVPFRTLTGRQSYYVDHEVFQQFGESLPVYKPTLPPMVFGNRDKKIKGGTDALVL
    NCTC8325        TNIERLVPFRTLTGRQSYYVDHEVFQQFGESLPVYKPTLPPMVFGNRDKKIKGGTDALVL
    Newman          TNIERLVPFRTLTGRQSYYVDHEVFQQFGESLPVYKPTLPPMVFGNRDKKIKGGTDALVL
    USA300_FPR3757  TNIERLVPFRTLTGRQSYYVDHEVFQQFGESLPVYKPTLPPMVFGNRDKKIKGGTDALVL
                    ************************************************************

    COL             RYLTPHGKWNIHSMYQDNKHMLTLFRGGPTVWISNEDAEKHDIQDNDWLEVYNRNGVVTA
    N315            RYLTPHGKWNIHSMYQDNKHMLTLFRGGPTVWISNEDAEKHDIQDNDWLEVYNRNGVVTA
    NCTC8325        RYLTPHGKWNIHSMYQDNKHMLTLFRGGPTVWISNEDAEKHDIQDNDWLEVYNRNGVVTA
    Newman          RYLTPHGKWNIHSMYQDNKHMLTLFRGGPTVWISNEDAEKHDIQDNDWLEVYNRNGVVTA
    USA300_FPR3757  RYLTPHGKWNIHSMYQDNKHMLTLFRGGPTVWISNEDAEKHDIQDNDWLEVYNRNGVVTA
                    ************************************************************

    COL             RAVISHRMPKGTMFMYHAQDKHIQTPGSEITDTRGGSHNAPTRIHLKPTQLVGGYAQISY
    N315            RAVISHRMPKGTMFMYHAQDKHIQTPGSEITDTRGGSHNAPTRIHLKPTQLVGGYAQISY
    NCTC8325        RAVISHRMPKGTMFMYHAQDKHIQTPGSEITDTRGGSHNAPTRIHLKPTQLVGGYAQISY
    Newman          RAVISHRMPKGTMFMYHAQDKHIQTPGSEITDTRGGSHNAPTRIHLKPTQLVGGYAQISY
    USA300_FPR3757  RAVISHRMPKGTMFMYHAQDKHIQTPGSEITDTRGGSHNAPTRIHLKPTQLVGGYAQISY
                    ************************************************************

    COL             HFNYYGPIGNQRDLYVAVRKMKEVNWLED
    N315            HFNYYGPIGNQRDLYVAVRKMKEVNWLED
    NCTC8325        HFNYYGPIGNQRDLYVAVRKMKEVNWLED
    Newman          HFNYYGPIGNQRDLYVAVRKMKEVNWLED
    USA300_FPR3757  HFNYYGPIGNQRDLYVAVRKMKEVNWLED
                    *****************************