From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005933000
  • symbol?: nirR
  • description?: cobalamin biosynthesis protein CbiX

      descriptions from strain specific annotations:

    • cobalamin biosynthesis protein CbiX
    • nitrite reductase transcriptional regulator NirR
    • transcriptional regulator NirR
    • Sirohydrochlorin ferrochelatase
    • cbiX family protein
    • cobalamin (vitamin B12) biosynthesis CbiX protein
    • fumarate and nitrate reduction regulatory protein
    • NirR protein
    • Regulatory protein
    • sirohydrochlorin cobalt chelatase
    • Sirohydrochlorin cobaltochelatase
  • strand?: -
  • coordinates?: 5999878..6000618
  • synteny block?: BlockID0046770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2399 (nirR)
    N315:
    NCTC8325:
    Newman:
    NWMN_2301 (nirR)
    USA300_FPR3757:
    04-02981:
    SA2981_2338 (nirR)
    08BA02176:
    C248_2448 (nasR)
    11819-97:
    MS7_2416
    71193:
    ST398NM01_2454
    ECT-R 2:
    ECTR2_2260
    ED133:
    SAOV_2447c
    ED98:
    SAAV_2466 (nirR)
    HO 5096 0412:
    SAEMRSA15_23000
    JH1:
    SaurJH1_2473
    JH9:
    SaurJH9_2425
    JKD6008:
    SAA6008_02442 (cbiX)
    JKD6159:
    SAA6159_02302 (cbiX)
    LGA251:
    SARLGA251_21830
    M013:
    M013TW_2362
    MRSA252:
    SAR2490
    MSHR1132:
    SAMSHR1132_22290
    MSSA476:
    SAS2292
    Mu3:
    SAHV_2385
    Mu50:
    SAV2401
    MW2:
    MW2323
    RF122:
    SAB2281c
    ST398:
    SAPIG2454
    T0131:
    SAT0131_02592 (pyrF)
    TCH60:
    HMPREF0772_10786 (nirR)
    TW20:
    SATW20_25310
    USA300_TCH1516:
    USA300HOU_2383 (nirR)
    VC40:
    SAVC_10875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNGNIIVAHGMRHGRQNQALEAFISELVKDDIHHYDIAFLESEHQDLETVMTTLIQSGVD
    N315            MNGNIIVAHGMRHGRQNQALEAFISELVKDDIHHYDIAFLESEHQDLETVMTTLIQSGVD
    NCTC8325        MNGNIIVAHGMRHGRQNQALEAFISELVKDDIHHYDIAFLESEHQDLETVMTTLIQSGVD
    Newman          MNGNIIVAHGMRHGRQNQALEAFISELVKDDIHHYDIAFLESEHQDLETVMTTLIQSGVD
    USA300_FPR3757  MNGNIIVAHGMRHGRQNQALEAFISELVKDDIHHYDIAFLESEHQDLETVMTTLIQSGVD
                    ************************************************************

    COL             HFKIVPLLIFSAMHYLKDIPNIVHEMKRRYPDIKVEVSEPLGTHPLMRRLIEQRICDALA
    N315            HFKIVPLLIFSAMHYLKDIPNIVHEMKRRYPDIKVEVSEPLGTHPLMRRLIEQRICDALA
    NCTC8325        HFKIVPLLIFSAMHYLKDIPNIVHEMKRRYPDIKVEVSEPLGTHPLMRRLIEQRICDALA
    Newman          HFKIVPLLIFSAMHYLKDIPNIVHEMKRRYPDIKVEVSEPLGTHPLMRRLIEQRICDALA
    USA300_FPR3757  HFKIVPLLIFSAMHYLKDIPNIVHEMKRRYPDIKVEVSEPLGTHPLMRRLIEQRICDALA
                    ************************************************************

    COL             GDEQQVGVMVVAHGNINGKFTKAHEELQICAQNLQISKPTYARTLYGEISFTHDLESISK
    N315            GDEQQVGVMVVAHGNINGNFTKAHEELQICAQHLQINKPTYARTLYGEISFTHDLESISK
    NCTC8325        GDEQQVGVMVVAHGNINGKFTKAHEELQICAQNLQISKPTYARTLYGEISFTHDLESISK
    Newman          GDEQQVGVMVVAHGNINGKFTKAHEELQICAQNLQISKPTYARTLYGEISFTHDLESISK
    USA300_FPR3757  GDEQQVGVMVVAHGNINGKFTKAHEELQICAQNLQISKPTYARTLYGEISFTHDLESISK
                    ******************:*************:***.***********************

    COL             RYQKLIVVPLFLYDGRLVNKVKQQMNDMVINTDIHFTPSINFDPILKQIINDRLESLMIP
    N315            RYQKLIVVPLFLYDGRLVNKVKQQMNDMVINTDIHFTPSINFDPILKQIINDRLESLMIP
    NCTC8325        RYQKLIVVPLFLYDGRLVNKVKQQMNDMVINTDIHFTPSINFDPILKQIINDRLESLMIP
    Newman          RYQKLIVVPLFLYDGRLVNKVKQQMNDMVINTDIHFTPSINFDPILKQIINDRLESLMIP
    USA300_FPR3757  RYQKLIVVPLFLYDGRLVNKVKQQMNDMVINTDIHFTPSINFDPILKQIINDRLESLMIP
                    ************************************************************

    COL             MKI
    N315            MKI
    NCTC8325        MKI
    Newman          MKI
    USA300_FPR3757  MKI
                    ***