From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005936000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 6003155..6003340
  • synteny block?: BlockID0046800
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2341
    08BA02176:
    C248_2451
    11819-97:
    MS7_2419
    71193:
    ST398NM01_2457
    ECT-R 2:
    ECTR2_2263
    ED133:
    SAOV_2450c
    ED98:
    SAAV_2469
    HO 5096 0412:
    SAEMRSA15_23030
    JH1:
    SaurJH1_2476
    JH9:
    SaurJH9_2428
    JKD6008:
    SAA6008_02445
    JKD6159:
    SAA6159_02305
    LGA251:
    SARLGA251_21860
    M013:
    M013TW_2365
    MRSA252:
    SAR2494
    MSHR1132:
    SAMSHR1132_22320
    MSSA476:
    SAS2295
    Mu3:
    SAHV_2388
    Mu50:
    SAV2404
    MW2:
    MW2326
    RF122:
    SAB2284c
    ST398:
    SAPIG2457
    T0131:
    SAT0131_02595
    TCH60:
    HMPREF0772_10783
    TW20:
    SATW20_25340
    USA300_TCH1516:
    VC40:
    SAVC_10890

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MVERYIKVLILYIFTTLLSSISVTSKCVPNKVIRFILRTAIGYSIFAYGLHYFSNLKKNK
    NCTC8325        MVERYIKVLILYIFTTLLSSISVTSKCVPNKVIRFILRTAIGYSVFAYGLHYFSNLKKNK
    Newman          MVERYIKVLILYIFTTLLSSISVTSKCVPNKVIRFILRTAIGYSVFAYGLHYFSNLKKNK
                    ********************************************:***************