From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005948000
  • symbol?: tcyA
  • description?: amino acid ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • amino acid ABC transporter substrate-binding protein
    • extracellular solute-binding protein
    • Cysteine ABC transporter, substrate-binding protein
    • L-cystine-binding protein tcyA
    • cysteine ABC transporter substrate-binding protein
    • extracellular amino acid binding ABC transporter
    • extracellular solute-binding lipoprotein
    • amino acid ABC transporter amino acid-binding protein
    • amino acid ABC transporter ATP-binding protein
    • amino acid ABC superfamily ATP binding cassette transporter, binding protein
  • strand?: -
  • coordinates?: 6011672..6012451
  • synteny block?: BlockID0046920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2351
    08BA02176:
    C248_2459
    11819-97:
    MS7_2429 (tcyA)
    71193:
    ST398NM01_2465
    ECT-R 2:
    ECTR2_2273
    ED133:
    SAOV_2460c
    ED98:
    SAAV_2479
    HO 5096 0412:
    SAEMRSA15_23130
    JH1:
    SaurJH1_2487
    JH9:
    SaurJH9_2439
    JKD6008:
    SAA6008_02455
    JKD6159:
    SAA6159_02315
    LGA251:
    SARLGA251_21960
    M013:
    M013TW_2375
    MRSA252:
    SAR2504
    MSHR1132:
    SAMSHR1132_22420
    MSSA476:
    SAS2305
    Mu3:
    SAHV_2398
    Mu50:
    SAV2414
    MW2:
    MW2336
    RF122:
    SAB2294c
    ST398:
    SAPIG2465
    T0131:
    SAT0131_02605 (def2)
    TCH60:
    HMPREF0772_10773 (tcyA)
    TW20:
    SATW20_25440
    USA300_TCH1516:
    USA300HOU_2395
    VC40:
    SAVC_10940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
    N315            MKRLLFVMIAFVFILAACGNNSSKDKEANKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
    NCTC8325        MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
    Newman          MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
    USA300_FPR3757  MKRLLFVMIAFVFILAACGNNSSKDKEASKDSKTINVGTEGTYAPFSFHDKDGKLTGYDI
                    ****************************.*******************************

    COL             DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
    N315            DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
    NCTC8325        DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
    Newman          DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
    USA300_FPR3757  DVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSS
                    ************************************************************

    COL             AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
    N315            AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
    NCTC8325        AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
    Newman          AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
    USA300_FPR3757  AVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRV
                    ************************************************************

    COL             DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
    N315            DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
    NCTC8325        DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
    Newman          DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
    USA300_FPR3757  DGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEEN
                    ************************************************************

    COL             GELAKIGKKWFGQDVSKSK
    N315            GELAKIGKKWFGQDVSKSK
    NCTC8325        GELAKIGKKWFGQDVSKSK
    Newman          GELAKIGKKWFGQDVSKSK
    USA300_FPR3757  GELAKIGKKWFGQDVSKSK
                    *******************