From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2202 [new locus tag: SA_RS12625 ]
  • pan locus tag?: SAUPAN005948000
  • symbol: SA2202
  • pan gene symbol?: tcyA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2202 [new locus tag: SA_RS12625 ]
  • symbol: SA2202
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2470801..2471580
  • length: 780
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAAGACTTTTATTTGTGATGATAGCTTTCGTTTTCATATTGGCTGCATGTGGAAAC
    AATTCGTCGAAAGACAAGGAAGCTAATAAAGATAGCAAGACAATTAATGTTGGTACTGAG
    GGGACTTATGCACCATTTAGTTTCCATGATAAAGATGGTAAATTAACTGGTTACGATATT
    GATGTTATTAAAGCAGTGGCTAAAGAAGAAGGTTTAAAACTTAAATTTAATGAAACTTCT
    TGGGATTCTATGTTTGCAGGTTTAGACGCAGGGCGTTTTGATGTAATCGCGAACCAAGTA
    GGTATTAATCCTGATAGAGAAAAGAAATATAAATTTTCTAAGCCTTACACATTCTCAAGT
    GCTGTTTTAGTTATTCGTGAAAATGAAAAAGATATTAAAGATTTTGATGATGTTAAAGGT
    AAGAAGTTAGCACAAACATTCACATCTAATTATGGTAAATTAGCTAAGGATAAAGGTGCT
    GATATTACAAAAGTTGATGGCTTTAACCAATCAATGGATTTATTATTGTCTAAGCGTGTT
    GATGGTACATTTAATGATAGTCTGTCATACTTGGATTATAAAAAACAAAAACCTAATGCT
    AAGATCAAAGCAATCAAAGGTAATGCTGAACAAAGTAGATCTGCATTTGCATTTTCTAAA
    AAAGCAGATGATGAAACAGTTCAAAAATTCAATGATGGCTTGAAAAAAATCGAGGAAAAC
    GGTGAATTAGCTAAAATAGGTAAGAAATGGTTTGGTCAAGATGTTTCTAAATCTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2202 [new locus tag: SA_RS12625 ]
  • symbol: SA2202
  • description: hypothetical protein
  • length: 259
  • theoretical pI: 9.8833
  • theoretical MW: 28930.7
  • GRAVY: -0.630116

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAmino acids, peptides and amineslysine-arginine-ornithine-binding periplasmic protein (TIGR01096; HMM-score: 133.8)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesectoine/hydroxyectoine ABC transporter solute-binding protein EhuB (TIGR02995; HMM-score: 81.4)
    extracellular substrate-binding orphan protein, GRRM family (TIGR04262; HMM-score: 20)
    MetabolismEnergy metabolismOthermethanol oxidation system protein MoxJ (TIGR03870; HMM-score: 19.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsmethanol oxidation system protein MoxJ (TIGR03870; HMM-score: 19.9)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 13.6)
  • TheSEED:  
    L-Cystine Uptake and Metabolism L-cystine ABC transporter, substrate-binding protein TcyA 
  • PFAM:
    PBP (CL0177) SBP_bac_3; Bacterial extracellular solute-binding proteins, family 3 (PF00497; HMM-score: 203.7)
    Lig_chan-Glu_bd; Ligated ion channel L-glutamate- and glycine-binding site (PF10613; HMM-score: 24.1)
    Phosphonate-bd; ABC transporter, phosphonate, periplasmic substrate-binding protein (PF12974; HMM-score: 21.5)
    NMT1; NMT1/THI5 like (PF09084; HMM-score: 13.6)
    no clan definedSspK; Small acid-soluble spore protein K family (PF08176; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA0033(aadD)kanamycin nucleotidyltransferase  [1] (data from MRSA252)
    SA1075(acpP)acyl carrier protein  [1] (data from MRSA252)
    SA2428(arcA)arginine deiminase  [1] (data from MRSA252)
    SA1984(asp23)alkaline shock protein 23  [1] (data from MRSA252)
    SA1517(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    SA0731(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    SA1553(fhs)formate--tetrahydrofolate ligase  [1] (data from MRSA252)
    SA0727(gap)glyceraldehyde-3-phosphate dehydrogenase  [1] (data from MRSA252)
    SA1959(glmS)glucosamine--fructose-6-phosphate aminotransferase  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA1504(infC)translation initiation factor IF-3  [1] (data from MRSA252)
    SA2074(modA)molybdate-binding protein  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA0218(pflB)formate acetyltransferase  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA2341(rocA)1-pyrroline-5-carboxylate dehydrogenase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SA2047(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SA2033(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA1502(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA1099(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    SA2041(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    SAS052(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    SA2048(rpsJ)30S ribosomal protein S10  [1] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SA2025(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    SA2043(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    SA0708(secA)preprotein translocase subunit SecA  [1] (data from MRSA252)
    SA0107(spa)immunoglobulin G binding protein A  [1] (data from MRSA252)
    SA1245(sucA)2-oxoglutarate dehydrogenase E1  [1] (data from MRSA252)
    SA1100(tsf)elongation factor Ts  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0618hypothetical protein  [1] (data from MRSA252)
    SA1709hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILAACGN
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.512
    • Ymax_pos: 25
    • Cmax: 0.317
    • Cmax_pos: 25
    • Smax: 0.919
    • Smax_pos: 15
    • Smean: 0.836
    • D: 0.638
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKRLLFVMIAFVFILAACGNNSSKDKEANKDSKTINVGTEGTYAPFSFHDKDGKLTGYDIDVIKAVAKEEGLKLKFNETSWDSMFAGLDAGRFDVIANQVGINPDREKKYKFSKPYTFSSAVLVIRENEKDIKDFDDVKGKKLAQTFTSNYGKLAKDKGADITKVDGFNQSMDLLLSKRVDGTFNDSLSYLDYKKQKPNAKIKAIKGNAEQSRSAFAFSKKADDETVQKFNDGLKKIEENGELAKIGKKWFGQDVSKSK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1453 (CymR*)
    CymR* (TF) important in Cysteine metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]