From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005958000
  • symbol?: hlgA
  • description?: gamma-hemolysin component A

      descriptions from strain specific annotations:

    • gamma-hemolysin component A
    • gamma-hemolysin subunit II
    • gamma-hemolysin chain II
    • beta-channel forming cytolysin
    • gamma-hemolysin chain II precursor
    • gamma-hemolysin, component A
    • gamma-hemolysin component A precursor
    • gamma-hemolysin h-gamma-II subunit
    • gamma-hemolysin component A precursor, HlgA
    • leukocidin-S subunit
  • strand?: +
  • coordinates?: 6019481..6020446
  • synteny block?: BlockID0047020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2419 (hlgA)
    N315:
    SA2207 (hlgA)
    NCTC8325:
    Newman:
    NWMN_2318 (hlgA)
    USA300_FPR3757:
    04-02981:
    SA2981_2356 (hlgA)
    08BA02176:
    C248_2466 (hlgA)
    11819-97:
    MS7_2434 (hlgA)
    71193:
    ST398NM01_2471
    ECT-R 2:
    ECTR2_2278
    ED133:
    SAOV_2467
    ED98:
    SAAV_2485 (hlgA)
    HO 5096 0412:
    SAEMRSA15_23180 (hlgA)
    JH1:
    SaurJH1_2493
    JH9:
    SaurJH9_2445
    JKD6008:
    SAA6008_02460 (hlgA)
    JKD6159:
    SAA6159_02320 (hlgA)
    LGA251:
    SARLGA251_22010 (hlgA)
    M013:
    M013TW_2380
    MRSA252:
    SAR2509 (hlgA)
    MSHR1132:
    SAMSHR1132_22480
    MSSA476:
    SAS2310
    Mu3:
    SAHV_2403 (hlgA)
    Mu50:
    SAV2419 (hlgA)
    MW2:
    MW2342 (hlgA)
    RF122:
    SAB2300 (hlgA)
    ST398:
    SAPIG2471
    T0131:
    SAT0131_02612
    TCH60:
    HMPREF0772_10768 (hlgA)
    TW20:
    SATW20_25490 (hlgA)
    USA300_TCH1516:
    USA300HOU_2402 (hlgA)
    VC40:
    SAVC_10970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNI
    N315            MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNI
    NCTC8325        MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNI
    Newman          MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNI
    USA300_FPR3757  MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNI
                    ************************************************************

    COL             QFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDL
    N315            QFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDL
    NCTC8325        QFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDL
    Newman          QFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDL
    USA300_FPR3757  QFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDL
                    ************************************************************

    COL             INYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNS
    N315            INYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNS
    NCTC8325        INYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNS
    Newman          INYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNS
    USA300_FPR3757  INYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNS
                    ************************************************************

    COL             KGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFIT
    N315            KGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFIT
    NCTC8325        KGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFIT
    Newman          KGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFIT
    USA300_FPR3757  KGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFIT
                    ************************************************************

    COL             TLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHE
    N315            TLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHE
    NCTC8325        TLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHE
    Newman          TLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHE
    USA300_FPR3757  TLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHE
                    ************************************************************

    COL             VKIKSITPK
    N315            VKIKSITPK
    NCTC8325        VKIKSITPK
    Newman          VKIKSITPK
    USA300_FPR3757  VKIKSITPK
                    *********