From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005961000
  • symbol?: hlgB
  • description?: gamma-hemolysin component B

      descriptions from strain specific annotations:

    • gamma-hemolysin component B
    • gamma hemolysin, component B
    • leukocidin f subunit
    • leukocidin-F subunit (Gamma-hemolysin, H-gamma-I subunit)
    • beta-channel forming cytolysin
    • gamma-hemolysin component C precursor, HlgB
  • strand?: +
  • coordinates?: 6023116..6023923
  • synteny block?: BlockID0047050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2422 (hlgB)
    N315:
    SA2209 (hlgB)
    NCTC8325:
    Newman:
    NWMN_2320 (hlgB)
    USA300_FPR3757:
    04-02981:
    SA2981_2358 (hlgB)
    08BA02176:
    C248_2469 (hlgB)
    11819-97:
    MS7_2436
    71193:
    ST398NM01_2474
    ECT-R 2:
    ECTR2_2280
    ED133:
    SAOV_2470
    ED98:
    SAAV_2487 (hlgB)
    HO 5096 0412:
    SAEMRSA15_23200 (hlgB)
    JH1:
    SaurJH1_2495
    JH9:
    SaurJH9_2447
    JKD6008:
    SAA6008_02462 (hlgB)
    JKD6159:
    SAA6159_02322 (hlgB)
    LGA251:
    SARLGA251_22030 (hlgB)
    M013:
    M013TW_2383
    MRSA252:
    SAR2511 (hlgB)
    MSHR1132:
    SAMSHR1132_22500
    MSSA476:
    SAS2312
    Mu3:
    SAHV_2405 (hlgB)
    Mu50:
    SAV2421 (hlgB)
    MW2:
    MW2344 (hlgB)
    RF122:
    SAB2302 (hlgB)
    ST398:
    SAPIG2474
    T0131:
    SAT0131_02616 (phoB)
    TCH60:
    HMPREF0772_10766 (hlgB)
    TW20:
    SATW20_25510 (hlgB)
    USA300_TCH1516:
    USA300HOU_2405 (hlgB)
    VC40:
    SAVC_10980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
    N315            MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
    NCTC8325        MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
    Newman          MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
    USA300_FPR3757  MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
                    ************************************************************

    COL             ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV
    N315            ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV
    NCTC8325        ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV
    Newman          ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV
    USA300_FPR3757  ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV
                    ************************************************************

    COL             NVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLS
    N315            NVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLS
    NCTC8325        NVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLS
    Newman          NVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLS
    USA300_FPR3757  NVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLS
                    ************************************************************

    COL             RNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMP
    N315            RNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMP
    NCTC8325        RNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMP
    Newman          RNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMP
    USA300_FPR3757  RNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMP
                    ************************************************************

    COL             LLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF
    N315            LLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF
    NCTC8325        LLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF
    Newman          LLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF
    USA300_FPR3757  LLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF
                    ************************************************************

    COL             KSTYEIDWENHKVKLLDTKETENNK
    N315            KSTYEIDWENHKVKLLDTKETENNK
    NCTC8325        KSTYEIDWENHKVKLLDTKETENNK
    Newman          KSTYEIDWENHKVKLLDTKETENNK
    USA300_FPR3757  KSTYEIDWENHKVKLLDTKETENNK
                    *************************