From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2422 [new locus tag: SACOL_RS12710 ]
  • pan locus tag?: SAUPAN005961000
  • symbol: hlgB
  • pan gene symbol?: hlgB
  • synonym:
  • product: gamma hemolysin, component B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2422 [new locus tag: SACOL_RS12710 ]
  • symbol: hlgB
  • product: gamma hemolysin, component B
  • replicon: chromosome
  • strand: +
  • coordinates: 2481010..2481987
  • length: 978
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGAAAATGAATAAATTAGTCAAATCATCCGTTGCTACATCTATGGCATTATTATTACTT
    TCTGGTACTGCTAATGCTGAAGGTAAAATAACACCAGTCAGCGTAAAAAAAGTCGATGAC
    AAAGTTACTTTATACAAAACAACAGCCACAGCAGATTCTGATAAATTTAAAATTTCACAG
    ATTTTAACATTTAATTTCATCAAAGATAAAAGTTATGATAAAGATACTTTAGTACTTAAA
    GCTACTGGGAATATTAACTCAGGCTTTGTGAAACCTAATCCTAATGACTATGACTTTTCA
    AAATTATATTGGGGAGCTAAATACAATGTATCTATAAGCTCACAATCTAATGATTCAGTA
    AACGTCGTTGATTATGCACCAAAAAATCAAAATGAAGAGTTTCAAGTTCAAAATACTTTA
    GGCTATACATTTGGTGGTGACATTAGTATCTCTAATGGTTTATCTGGTGGACTTAATGGA
    AATACAGCTTTTTCTGAAACAATTAATTATAAACAAGAAAGTTACAGAACAACATTAAGT
    CGCAACACAAATTATAAAAATGTTGGCTGGGGAGTTGAAGCACATAAAATTATGAATAAT
    GGTTGGGGACCTTATGGAAGAGATAGCTTCCACCCAACATATGGTAATGAACTCTTCTTA
    GCTGGCAGACAAAGCAGTGCATACGCTGGCCAAAACTTCATAGCGCAACACCAAATGCCA
    TTATTATCTAGAAGTAACTTCAATCCAGAATTTTTAAGCGTACTATCACACAGACAAGAT
    GGCGCTAAAAAATCTAAAATTACAGTAACTTATCAACGTGAAATGGATTTATACCAAATT
    CGTTGGAATGGCTTCTACTGGGCAGGCGCAAATTATAAAAACTTTAAAACTAGAACATTT
    AAATCAACATATGAAATTGATTGGGAAAATCACAAAGTGAAATTGTTAGATACAAAAGAA
    ACTGAAAACAATAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    978

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2422 [new locus tag: SACOL_RS12710 ]
  • symbol: HlgB
  • description: gamma hemolysin, component B
  • length: 325
  • theoretical pI: 9.81402
  • theoretical MW: 36710.8
  • GRAVY: -0.669538

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesToxin production and resistancebeta-channel forming cytolysin (TIGR01002; HMM-score: 413.2)
  • TheSEED:  
    Staphylococcus Two-component and Pore-forming Cytolysins Cytolytic pore-forming protein F component => Gamma-hemolysin HlgB 
  • PFAM:
    Leukocidin (CL0636) Leukocidin; Leukocidin/Hemolysin toxin family (PF07968; HMM-score: 295.5)
    E-set (CL0159) fn3; Fibronectin type III domain (PF00041; HMM-score: 14.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: GTANAEGK
  • SignalP: Signal peptide length 27 aa
    • Ymax: 0.651
    • Ymax_pos: 27
    • Cmax: 0.486
    • Cmax_pos: 27
    • Smax: 0.973
    • Smax_pos: 8
    • Smean: 0.911
    • D: 0.752
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Signal peptide containing [1] [2]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SaeR
    SaeR (TF) important in VirulenceRegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]