From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005963000
  • symbol?: bioW
  • description?: 6-carboxyhexanoate--CoA ligase

      descriptions from strain specific annotations:

    • 6-carboxyhexanoate--CoA ligase
    • 6-carboxyhexanoate--CoA ligase family protein
    • Pimeloyl-CoA synthase
    • pseudogene
    • putative 6-carboxyhexanoate--CoA ligase
  • strand?: -
  • coordinates?: 6024624..6025301
  • synteny block?: BlockID0047070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2424 (bioW)
    N315:
    NCTC8325:
    Newman:
    NWMN_2322 (bioW)
    USA300_FPR3757:
    04-02981:
    SA2981_2360
    08BA02176:
    C248_2471
    11819-97:
    MS7_2438
    71193:
    ST398NM01_2476
    ECT-R 2:
    ECTR2_2282
    ED133:
    SAOV_2472c
    ED98:
    SAAV_2489 (bioW)
    HO 5096 0412:
    SAEMRSA15_23220
    JH1:
    SaurJH1_2497
    JH9:
    SaurJH9_2449
    JKD6008:
    SAA6008_02465 (bioW)
    JKD6159:
    SAA6159_02324 (bioW)
    LGA251:
    SARLGA251_22050
    M013:
    M013TW_2385
    MRSA252:
    SAR2513
    MSHR1132:
    SAMSHR1132_22520
    MSSA476:
    SAS2314
    Mu3:
    SAHV_2407
    Mu50:
    SAV2423
    MW2:
    MW2346
    RF122:
    SAB2304c
    ST398:
    SAPIG2476
    T0131:
    SAT0131_02618
    TCH60:
    HMPREF0772_10764 (bioW)
    TW20:
    SATW20_25530
    USA300_TCH1516:
    USA300HOU_2407 (bioW)
    VC40:
    SAVC_10990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYSIKMRSSNQDVHISGAETICEFDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIMEPI
    N315            MYSIKMRSSNQDVHISGAETICEFDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIMEPI
    NCTC8325        MYSIKMRSSNQDVHISGAETICEFDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIMEPI
    Newman          MYSIKMRSSNQDVHISGAETICEFDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIMEPI
    USA300_FPR3757  MYSIKMRSSNQDVHISGAETICEFDKIEQTVQRFYNKGFFHENGQPDFLNIKIQKIMEPI
                    ************************************************************

    COL             QQIKALQIIEDDKANLQHLTQECGVTEQALNQGMTYIKNETVYTGAIILSAISGKRLDSF
    N315            QQIKALQIIEDDKANLQHLTQECGVTEQALNQGMTYIKNETVYTGAIILSAISGKRLDSF
    NCTC8325        QQIKALQIIEDDKANLQHLTQECGVTEQALNQGMTYIKNETVYTGAIILSAISGKRLDSF
    Newman          QQIKALQIIEDDKANLQHLTQECGVTEQALNQGMTYIKNETVYTGAIILSAISGKRLDSF
    USA300_FPR3757  QQIKALQIIEDDKANLQHLTQECGVTEQALNQGMTYIKNETVYTGAIILSAISGKRLDSF
                    ************************************************************

    COL             GQRGIRATHFSFEDINNKGDLNERVTDALAIASCINAHPYVKGELCVSDDLTYTTGYFAA
    N315            GQRGIRATHFSFEDINNKGDLNERVTDALAIASCINAHPYVKGELCVSDDLTYTTGYFAA
    NCTC8325        GQRGIRATHFSFEDINNKGDLNERVTDALAIASCINAHPYVKGELCVSDDLTYTTGYFAA
    Newman          GQRGIRATHFSFEDINNKGDLNERVTDALAIASCINAHPYVKGELCVSDDLTYTTGYFAA
    USA300_FPR3757  GQRGIRATHFSFEDINNKGDLNERVTDALAIASCINAHPYVKGELCVSDDLTYTTGYFAA
                    ************************************************************

    COL             AKIGYHRLFDIKPVNTRYGGRIIFVDDCIDLNHYISFLESTPKQVVYETV
    N315            AKIGYHRLFDIKPVNTRYGGRIIFVDDCIDLNHYISFLESTPKQVVYETV
    NCTC8325        AKIGYHRLFDIKPVNTRYGGRIIFVDDCIDLNHYISFLESTPKQVVYETV
    Newman          AKIGYHRLFDIKPVNTRYGGRIIFVDDCIDLNHYISFLESTPKQVVYETV
    USA300_FPR3757  AKIGYHRLFDIKPVNTRYGGRIIFVDDCIDLNHYISFLESTPKQVVYETV
                    **************************************************