From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005964000
  • symbol?: bioF
  • description?: 8-amino-7-oxononanoate synthase

      descriptions from strain specific annotations:

    • 8-amino-7-oxononanoate synthase
    • putative 8-amino-7-oxononanoate synthase
    • 8-amino-7-oxononanoate synthase, putative
    • aminotransferase, class II
    • aminotransferase class-V family protein
  • strand?: -
  • coordinates?: 6025322..6026443
  • synteny block?: BlockID0047080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2323 (bioF)
    USA300_FPR3757:
    04-02981:
    SA2981_2361
    08BA02176:
    C248_2472
    11819-97:
    MS7_2439
    71193:
    ST398NM01_2477
    ECT-R 2:
    ECTR2_2283
    ED133:
    SAOV_2473c
    ED98:
    SAAV_2490
    HO 5096 0412:
    SAEMRSA15_23230
    JH1:
    SaurJH1_2498
    JH9:
    SaurJH9_2450
    JKD6008:
    SAA6008_02466 (bioF)
    JKD6159:
    SAA6159_02325 (bioF)
    LGA251:
    SARLGA251_22060
    M013:
    M013TW_2386
    MRSA252:
    SAR2514
    MSHR1132:
    SAMSHR1132_22530
    MSSA476:
    SAS2315
    Mu3:
    SAHV_2408
    Mu50:
    SAV2424
    MW2:
    MW2347
    RF122:
    SAB2305c
    ST398:
    SAPIG2477
    T0131:
    SAT0131_02619
    TCH60:
    HMPREF0772_10763 (bioF)
    TW20:
    SATW20_25540
    USA300_TCH1516:
    USA300HOU_2408 (bioF)
    VC40:
    SAVC_10995

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFQEQIDLLQQKGLYRSLKSVGYIDRQYIEVENKRCTNYTSNDYLGLGQIAFDKDDFER
    N315            MMFQEQIDLLQQKGLYRSLKSVGYIDRQYIEVENKRCTNYTSNDYLGLGQIAFDKDDFER
    NCTC8325        MKFQEQIDLLQQKGLYRSLKSVGYIDRQYIEVENKRCTNYTSNDYLGLGQIAFDKDDFER
    Newman          MKFQEQIDLLQQKGLYRSLKSVGYIDRQYIEVENKRCTNYTSNDYLGLGQIAFDKDDFER
    USA300_FPR3757  MKFQEQIDLLQQKGLYRSLKSVGYIDRQYIEVENKRCTNYTSNDYLGLGQIAFDKDDFER
                    * **********************************************************

    COL             FMRKYSYHLSSSRLISGSSTAYEEIETMLAGWLGYSACTILNSGYDANLALFNIFKNTNC
    N315            FMRKYSYHLSSSRLISGSSTAYEEIETMLAGWLGYSACTILNSGYDANLALFNIFKNTNC
    NCTC8325        FMRKYSYHLSSSRLISGSSTAYEEIETMLAGWLGYSACTILNSGYDANLALFNIFKNTNC
    Newman          FMRKYSYHLSSSRLISGSSTAYEEIETMLAGWLGYSACTILNSGYDANLALFNIFKNTNC
    USA300_FPR3757  FMRKYSYHLSSSRLISGSSTAYEEIETMLAGWLGYSACTILNSGYDANLALFNIFKNTNC
                    ************************************************************

    COL             VVFSDQENHASIIDGIKLSGLEKVIYKHLDIADLEKRLEKYPNQNIPKIIISDSVFSTNG
    N315            VVFSDQENHASIIDGIKLSGLEKVIYKHLDIADLEKRLEKYPNQNIPKIIISDSVFSTNG
    NCTC8325        VVFSDQENHASIIDGIKLSGLEKVIYKHLDIADLEKRLEKYPNQNIPKIIISDSVFSTNG
    Newman          VVFSDQENHASIIDGIKLSGLEKVIYKHLDIADLEKRLEKYPNQNIPKIIISDSVFSTNG
    USA300_FPR3757  VVFSDQENHASIIDGIKLSGLEKVIYKHLDIADLEKRLEKYPNQNIPKIIISDSVFSTNG
                    ************************************************************

    COL             DVVDIGQLVSLKHKYNATLILDVSHSFGIENYSNYQGVDILTSSLSKACGAYGGVILSSN
    N315            DVVDIGQLVSLKHKYNATLILDVSHSFGIENYSNYQGVDILTSSLSKACGAYGGVILSSN
    NCTC8325        DVVDIGQLVSLKHKYNATLILDVSHSFGIENYSNYQGVDILTSSLSKACGAYGGVILSSN
    Newman          DVVDIGQLVSLKHKYNATLILDVSHSFGIENYSNYQGVDILTSSLSKACGAYGGVILSSN
    USA300_FPR3757  DVVDIGQLVSLKHKYNATLILDVSHSFGIENYSNYQGVDILTSSLSKACGAYGGVILSSN
                    ************************************************************

    COL             DVKDMLINHGRPLIYSSSLPIYNLYFIKRNIEKLINADDRRTKLNSLSKYFNQKLKALNV
    N315            DVKDMLINHGRPLIYSSSLPIYNLYFIKRNIEKLINADDRRTKLNSLSKYFNQKLKALNV
    NCTC8325        DVKDMLINHGRPLIYSSSLPIYNLYFIKRNIEKLINADDRRTKLNSLSKYFNQKLKALNV
    Newman          DVKDMLINHGRPLIYSSSLPIYNLYFIKRNIEKLINADDRRTKLNSLSKYFNQKLKALNV
    USA300_FPR3757  DVKDMLINHGRPLIYSSSLPIYNLYFIKRNIEKLINADDRRTKLNSLSKYFNQKLKALNV
                    ************************************************************

    COL             NYNSSNSPIKFIEFDDIEAAENIHQTLLKHHVFTSYLRYPTVTKPMLRISLSYFHTEQDI
    N315            NYNSSNSPIKFIEFDDIEAAENIHQTLLKHHVFTSYLRYPTVTKPMLRISLSYFHTEQDI
    NCTC8325        NYNSSNSPIKFIEFDDIEAAENIHQTLLKHHVFTSYLRYPTVTKPMLRISLSYFHTEQDI
    Newman          NYNSSNSPIKFIEFDDIEAAENIHQTLLKHHVFTSYLRYPTVTKPMLRISLSYFHTEQDI
    USA300_FPR3757  NYNSSNSPIKFIEFDDIEAAENIHQTLLKHHVFTSYLRYPTVTKPMLRISLSYFHTEQDI
                    ************************************************************

    COL             DRLFEILHQED
    N315            DRLFEILHQED
    NCTC8325        DRLFEILHQED
    Newman          DRLFEILHQED
    USA300_FPR3757  DRLFEILHQED
                    ***********