From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005978000
  • symbol?:
  • description?: GtrA family protein

      descriptions from strain specific annotations:

    • GtrA family protein
    • Putative sugar translocase in surface polysaccharides biosynthesis
    • gtrA-like family protein
    • GtrA-like integral membrane protein
    • Monosaccharide translocase (flippase type)
    • probable membrane protein
  • strand?: -
  • coordinates?: 6040260..6040646
  • synteny block?: BlockID0047220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2368
    08BA02176:
    C248_2480
    11819-97:
    MS7_2445
    71193:
    ST398NM01_2483
    ECT-R 2:
    ECTR2_2289
    ED133:
    SAOV_2481c
    ED98:
    SAAV_2497
    HO 5096 0412:
    SAEMRSA15_23310
    JH1:
    SaurJH1_2506
    JH9:
    SaurJH9_2457
    JKD6008:
    SAA6008_02472 (gtrA)
    JKD6159:
    SAA6159_02329 (gtrA)
    LGA251:
    SARLGA251_22120
    M013:
    M013TW_2394
    MRSA252:
    SAR2521
    MSHR1132:
    SAMSHR1132_22590
    MSSA476:
    SAS2323
    Mu3:
    SAHV_2415
    Mu50:
    SAV2431
    MW2:
    MW2355
    RF122:
    SAB2313c
    ST398:
    SAPIG2483
    T0131:
    SAT0131_02626 (recG)
    TCH60:
    HMPREF0772_10757
    TW20:
    SATW20_25600
    USA300_TCH1516:
    USA300HOU_2416
    VC40:
    SAVC_11030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCY
    N315            MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCY
    NCTC8325        MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCY
    Newman          MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCY
    USA300_FPR3757  MKLTQTHAEILKFIIVGGINTLNYYVVYLLLLKLLHIEYMISHITGFLVAFVISYYLNCY
                    ************************************************************

    COL             FVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLIITIPITFILS
    N315            FVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLVITIPITFVLS
    NCTC8325        FVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLIITIPITFILS
    Newman          FVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLIITIPITFILS
    USA300_FPR3757  FVYRVKPTWRKFISFPITQIVNVSLQTVLLYVFVSWLNLPAEIAPFAGLIITIPITFILS
                    *************************************************:*******:**

    COL             KWILKDSN
    N315            KWILKDSN
    NCTC8325        KWILKDSN
    Newman          KWILKDSN
    USA300_FPR3757  KWILKDSN
                    ********